Recombinant Full Length Bordetella Avium Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL17755BF |
Product Overview : | Recombinant Full Length Bordetella avium Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q2KYS6) (1-591aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bordetella avium |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-591) |
Form : | Lyophilized powder |
AA Sequence : | MIPGVREATAGHEPVKAELWKRIYSRVGSHWKGLILAVLLMAGAAATQPTLAVIMKPLID GGFAGDKPQYIWSVPLAVIGLILLRGVCNFFSDYLLAWVANNVLLGIRREMFDRLLGLPD ADFKRGDTGRLLNRFTIDAGNVTGYATDVITVLVRETLVVISLIAVLLYMSWLLTVIILV VMPISVWIARSFARRLRRINRETVNMNAELTRVVSEGIDGQRVIKLFDGYEAERGRFAYV NARLRRFAMRTAVADAALTPLTQVCIAVAVGAVIAVALGQANAGTLTAGAFAAFMSALAQ IFDPIKRLTNLASKMQKMLVSAESVFTLVDQIPEVDEGQRTLAEPVRGKIEFRQIGHRFP EADRNTISDVSFTVEPGQTVALVGRSGSGKTTLVNMLPRFVLPTEGSILIDDVPINDVQL NSLRSHLSLVSQDVVLFDDTIAANVGYGALGKADDQRIHDALAAANLRDFVDSLPKGIHT PVGENAARLSGGQRQRLAIARALIKNAPILILDEATSALDNESERQVQSSLDRLMRGRTT LVIAHRLSTVQNADRIIVLDAGRIVEHGAHTELLAAGGLYATLYNMQFRED |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; BAV2229; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q2KYS6 |
◆ Recombinant Proteins | ||
FFAR1-12852H | Recombinant Human FFAR1, GST-tagged | +Inquiry |
SLC25A37-5135R | Recombinant Rat SLC25A37 Protein, His (Fc)-Avi-tagged | +Inquiry |
DNAJC5-1124R | Recombinant Rhesus Macaque DNAJC5 Protein, His (Fc)-Avi-tagged | +Inquiry |
ERC1-12519H | Recombinant Human ERC1, His-tagged | +Inquiry |
RFL15434SF | Recombinant Full Length Bifunctional Protein Aas(Aas) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
MOMP-02C | Native C. trachomatis MOMP Antigen | +Inquiry |
ADPGK-45 | Active Native ADP-specific glucokinase | +Inquiry |
Glycated Albumin-006B | Native Bovine Glycated Albumin Protein | +Inquiry |
CAT-1646H | Native Human Catalase Protein | +Inquiry |
UO-44 | Active Native Urate oxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
TULP4-637HCL | Recombinant Human TULP4 293 Cell Lysate | +Inquiry |
C3orf39-8044HCL | Recombinant Human C3orf39 293 Cell Lysate | +Inquiry |
BTG4-193HCL | Recombinant Human BTG4 cell lysate | +Inquiry |
SLC30A8-1737HCL | Recombinant Human SLC30A8 293 Cell Lysate | +Inquiry |
LSAMP-1755HCL | Recombinant Human LSAMP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket