Recombinant Full Length Polaromonas Sp. Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL8034PF |
Product Overview : | Recombinant Full Length Polaromonas sp. Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q12C33) (1-589aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Polaromonas sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-589) |
Form : | Lyophilized powder |
AA Sequence : | MTQLSEPVPVSLAARRSLWQRVARVWPYFSGSRAGWALAIGATIVASATEPFVPALLKPL LDRGFQRDSFNLWLVPLALMLLFTVRGLSGFLAQFALAKVTNDGLLKLRGAMFDKLLSAR LTLFADQSSSAIANTVVYEVFNGSSMLINAIMKLARDVLTLLALIGYLVYLNWKLMLVVA LLFPAVAFVIQVLSKRLYRLTKESQTATDDLAYVVEENVMAHRDVRLHGAQAGQASRFNH LSNSLRRLSMKSTAAYAGMSAITQVLAAMALSAVISIALLQSAENTTTVGGFVAFVTAML LLIAPVKSLSDAATPVTRGLAALERGLDLMNLTPDESGGSFVKARAHGDIEFADVSVIYK ADAAAALDQFSLSIKAGETLAIVGASGSGKTTLVNLLPRFVEMSSGNIYLDGQDLRAWNL ASLRAQFAFVSQHVVMLNNSIAVNVALGQPVDRARVTECLAAANLSGLLAELPGGIDTIL GHNAMQLSGGQRQRLAIARALYKNAPILVLDEATSALDTESELAVQEAIKRLTASRTSLV IAHRLSTVQHADRIIMMEAGRMIESGTHAELLARNGAYAHLYRLGFRNT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; Bpro_1979; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q12C33 |
◆ Native Proteins | ||
Amylase-64H | Active Native Human Amylase, alpha | +Inquiry |
Arg1-8044R | Native Rat Liver Arginase | +Inquiry |
MUC1-135B | Native Bovine MUC1 Protein | +Inquiry |
LDH2-20H | Active Native Human Lactate Dehydrogenase 2 | +Inquiry |
PIP-20H | Native Human PIP Protein (118 aa) | +Inquiry |
◆ Cell & Tissue Lysates | ||
COQ4-385HCL | Recombinant Human COQ4 cell lysate | +Inquiry |
Ramos-023HCL | Human Ramos Whole Cell Lysate | +Inquiry |
TRIM24-789HCL | Recombinant Human TRIM24 293 Cell Lysate | +Inquiry |
MNT-412HCL | Recombinant Human MNT lysate | +Inquiry |
MRPL37-417HCL | Recombinant Human MRPL37 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket