Recombinant Full Length Haemophilus Somnus Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL30759HF |
Product Overview : | Recombinant Full Length Haemophilus somnus Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q0I4C5) (1-582aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Haemophilus somnus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-582) |
Form : | Lyophilized powder |
AA Sequence : | MQDKDLSTLQTFKRLWPTIAPFKLGLIASAVALVFNALADAALIQMLKPVLDEGFGKVDN SLLRIMAIVVVLLIFVRGVTNFISTYCLAWVSGKVVMVMRRRLFRHLMYMPVTFFDQNSV GRLLSRIVYDSEQVANSSSGSLVTIVREGAYIIALLTVMFYTSWQLALVLFIIGPIIAVI IRIVSKKFRELGKNLQNSMGDLTSSVEQMLKGHKVVLAFGGQKIEEERFDQVSNNMRRRG MKVMAASAISDPVVQIIASFALAAVLFLATLPEIMTQNLSAGSFTVVFSSMLAMMRPLKS LTNVNAQFQRGMAACQTLFALLDLETEKDTGKHVVDTVKGEVRFENVTFSYSGKEHPALN NISFTIPQGKTVALVGRSGSGKSTIANLVTRFYDVEQGKITLDGVNIQDYTLANLREHCA VVSQQVHLFNDTIANNIAYAVTEKCTREQIIEAAEAAYAMEFIEKLENGLDTVIGENGAS LSGGQRQRLAIARALLRDSPVLILDEATSALDTESERAIQAALETLQKDRTVLVIAHRLS TIEKADEILVIEQGEIKERGSHQELLALNGAYKQLHSTQFNH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; HS_1021; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q0I4C5 |
◆ Recombinant Proteins | ||
PSMD12-2408C | Recombinant Chicken PSMD12 | +Inquiry |
RFL22060MF | Recombinant Full Length Mouse Mitochondrial 2-Oxodicarboxylate Carrier(Slc25A21) Protein, His-Tagged | +Inquiry |
SGR-RS33235-702S | Recombinant Streptomyces griseus subsp. griseus NBRC 13350 SGR_RS33235 protein, His-tagged | +Inquiry |
SELENOP-3477B | Recombinant Bovine SELENOP protein, GST-tagged | +Inquiry |
FKBP14-1539R | Recombinant Rhesus Macaque FKBP14 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Angiostatin K1-4-22H | Native Human Angiostatin K1-4 Protein | +Inquiry |
FLNA-873T | Native Turkey FLNA Protein | +Inquiry |
R-PE-004R | Native Red Fluorescent Protein | +Inquiry |
SERPINA1-27286TH | Native Human SERPINA1 | +Inquiry |
KLC-212H | Native Human Kappa Light Chain | +Inquiry |
◆ Cell & Tissue Lysates | ||
C1QTNF3-8137HCL | Recombinant Human C1QTNF3 293 Cell Lysate | +Inquiry |
Epididymis-719P | Pig Epididymis Lysate, Total Protein | +Inquiry |
CNIH3-7408HCL | Recombinant Human CNIH3 293 Cell Lysate | +Inquiry |
RARA-2516HCL | Recombinant Human RARA 293 Cell Lysate | +Inquiry |
TNFSF9-1445RCL | Recombinant Rat TNFSF9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket