Recombinant Full Length Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL36748SF |
Product Overview : | Recombinant Full Length Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q83LP0) (1-582aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Shigella flexneri |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-582) |
Form : | Lyophilized powder |
AA Sequence : | MHNDKDLSTWQTFRRLWPTIAPFKAGLIVAGVALILNAASDTFMLSLLKPLLDDGFGKTD RSVLVWMPLVVIGLMILRGITSYVSSYCISWVSGKVVMTMRRRLFGHMMGMPVSFFDKQS TGTLLSRITYDSEQVASSSSGALITVVREGASIIGLFIMMFYYSWQLSIILIVLAPIVSI AIRVVSKRFRNISKNMQNTMGQVTTSAEQMLKGHKEVLIFGGQEVETKRFDKVSNRMRLQ GMKMVSASSISDPIIQLIASLALAFVLYAASFPSVMDNLTAGTITVVFSSMIALMRPLKS LTNVNAQFQRGMAACQTLFTILDSEQEKDEGKRVIERATGDVEFRNVTFTYPGRDVPALR NINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGEILMDGHDLREYTLASLRNQVA LVSQNVHLFNDTVANNIAYARTEQYSREQIEEAARMAYAMDFINKMDNGLDTVIGENGVL LSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLS TIEKADEIVVVEDGVIVERGTHNDLLEHRGVYAQLHKMQFGQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; SF0910; S0974; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q83LP0 |
◆ Recombinant Proteins | ||
APG3L-678H | Recombinant Human APG3L protein, GST-tagged | +Inquiry |
GPR158-5202H | Recombinant Human GPR158 Protein, GST-tagged | +Inquiry |
GP120-269H | Active Recombinant HIV-1 GP120 Protein, His-Avi-tagged, Biotinylated | +Inquiry |
IRAK3-5731HF | Recombinant Full Length Human IRAK3 Protein, GST-tagged | +Inquiry |
ELAC2-1730R | Recombinant Rat ELAC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
IGHA1-210H | Native Human Immunoglobulin A1 (IgA1) | +Inquiry |
ADA-P036B | Native Bovine adenosine deaminase therapeutic protein (Pegademase bovine) | +Inquiry |
Immunoglobulin E-80H | Native Human Immunoglobulin E | +Inquiry |
F2-5287M | Native Mouse Coagulation Factor II | +Inquiry |
IGHA1-18H | Native Human IgA1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
RFX2-2399HCL | Recombinant Human RFX2 293 Cell Lysate | +Inquiry |
MTMR7-4073HCL | Recombinant Human MTMR7 293 Cell Lysate | +Inquiry |
EYA2-6491HCL | Recombinant Human EYA2 293 Cell Lysate | +Inquiry |
DYNLRB1-6755HCL | Recombinant Human DYNLRB1 293 Cell Lysate | +Inquiry |
PNN-3074HCL | Recombinant Human PNN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket