Recombinant Full Length Aromatoleum Aromaticum Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL8594AF |
Product Overview : | Recombinant Full Length Aromatoleum aromaticum Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q5P2S7) (1-601aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Aromatoleum aromaticum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-601) |
Form : | Lyophilized powder |
AA Sequence : | MHRSDAAPASSIRIYFRLLSYVRPYVGLFAVSILGYVIFASSQPMLAGVLKYFVDGLTHP DAALVTGVPLLDGMELMHGVPLMIVLIAAWQGLGGYLGNYFLARVSLGLVHDLRQTLFDS LLRLPNTYFDQHSSGHLISRITFNVTMVTGAATDAIKIVIREGLTVVFLFAYLLWMNWRL TLVMVAILPLISLMVRNASGKFRKQSRKIQVAMGDVTHVASETIQGYRVVRSFGGEHYER ERFRAASEDNTRKQLKMVKTSAVYTPTLQLVTYSAMAVVLFLVLRLRGEASVGDLVAYIT AAGLLPKPIRQLSEVSSTIQRGVAGAESIFEQLDDKPEVDHGRIERERVSGRIEVRDLSF RYPGSDREVLDSVSFTVEPGQMIALVGRSGSGKSTLANLIPRFYHHDRGQILIDGVDVED YTLKNLRRHIALVTQQVTLFNDTVANNIAYGDLAGLPRAAVEAAAEAGYAKEFIDRLPQG FDTLIGENGVTLSGGQRQRLAIARALLKNAPILILDEATSALDTESERHIQAALHRVMQA RTTLVIAHRLSTIEQADVIMVMDHGRIVERGSHAELLAAGGHYARLHAMQFREEPAVAEG R |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; AZOSEA22620; ebA3992; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q5P2S7 |
◆ Recombinant Proteins | ||
EFNA2-1381H | Recombinant Human EFNA2 Protein, MYC/DDK-tagged | +Inquiry |
FAM83E-3807H | Recombinant Human FAM83E Protein, GST-tagged | +Inquiry |
PRKCZ-4811H | Recombinant Full Length Human PRKCZ, His-tagged | +Inquiry |
FKBP11-5901M | Recombinant Mouse FKBP11 Protein | +Inquiry |
RFL15541KF | Recombinant Full Length General Secretion Pathway Protein B(Pulb) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Hp-134M | Native Mouse Haptoglobin | +Inquiry |
MMP9-9810 | Active Native Human MMP9 | +Inquiry |
CMV-06 | Native Cytomegalovirus Antigen | +Inquiry |
TNNI3-01H | Native Human TNNI3 Protein | +Inquiry |
MV-02 | Native Measles Virus Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
WRB-282HCL | Recombinant Human WRB 293 Cell Lysate | +Inquiry |
PIWIL1-1359HCL | Recombinant Human PIWIL1 cell lysate | +Inquiry |
DIDO1-478HCL | Recombinant Human DIDO1 cell lysate | +Inquiry |
BEX5-8462HCL | Recombinant Human BEX5 293 Cell Lysate | +Inquiry |
ACE-9094HCL | Recombinant Human ACE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket