Recombinant Full Length Chromobacterium Violaceum Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL34996CF |
Product Overview : | Recombinant Full Length Chromobacterium violaceum Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q7NZU6) (1-584aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chromobacterium violaceum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-584) |
Form : | Lyophilized powder |
AA Sequence : | MKDSFKNSWAIYRRLLGYLLGYWKVLLLSMLSMAVAALTEPAVAKLLKPLIDGGFVNKDP QVIMWVPLAIIGIYLIRGLAGFINEYTASWLTGQLVQRLRQQMFAKLVNLPARYYDEHQS GRLMSRITNDVNQVTEAGFNVITVTVRDGLTALGMLGLMLTTDWQLTLICLVVMPAVTYC MRLVGQRLRGLARQNQQHMAQMTQVLAESIQCQRAIKVYGGQEREMARFDHTATSVRRNQ VKQSAASAANTGVTQLMIACALAAILYFAGLRAQHGGLTAGDFMVFLTAMLGLFAPVKRI SSVSQAMQRGLAAAESVFAFIDEPGEPDDGASALPATRGRLSFDAVSFAYPNVDSPALSG IDLEIQPGETVALVGSSGSGKTTLASLVPRFYEPSAGRLLLDGVPLADIPLRQLRGHIAL VSQQVELFNDTVAANIAYGREDASREEIVEAARAANAMEFIEGLPDGLETVIGENGARLS GGQRQRLAIARALLKNAPLLILDEATSALDTQSERLVQAALENLMKNRTTIVIAHRLSTI ENADRIVVMHQGRLAEQGRHQALLEQGGLYARLHSLQFSEPQAD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; CV_0825; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q7NZU6 |
◆ Recombinant Proteins | ||
SCO3792-1195S | Recombinant Streptomyces coelicolor A3(2) SCO3792 protein, His-tagged | +Inquiry |
IL17F-1139H | Recombinant Human IL17F protein(31-163aa), His-GST&Myc-tagged | +Inquiry |
RFL13080AF | Recombinant Full Length African Swine Fever Virus Envelope Protein P54 (Ken-138) Protein, His-Tagged | +Inquiry |
DES-196H | Recombinant Human DES | +Inquiry |
ASPHD2-5909HF | Recombinant Full Length Human ASPHD2 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
SERPINF2-27145TH | Native Human SERPINF2 | +Inquiry |
Chymotrypsin-163B | Active Native Bovine Chymotrypsin | +Inquiry |
RWV-307S | Native Snake RVV-V ACTIVATOR | +Inquiry |
PLD-17S | Active Native Streptomyces chromofuscus Phospholipase D | +Inquiry |
F2-90B | Active Native Bovine Thrombin | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLNS1A-7437HCL | Recombinant Human CLNS1A 293 Cell Lysate | +Inquiry |
CNDP2-637HCL | Recombinant Human CNDP2 cell lysate | +Inquiry |
GALNT2-907HCL | Recombinant Human GALNT2 cell lysate | +Inquiry |
TRIM16L-793HCL | Recombinant Human TRIM16L 293 Cell Lysate | +Inquiry |
GSTM5-760HCL | Recombinant Human GSTM5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket