Recombinant Full Length Paracoccidioides Brasiliensis Formation Of Crista Junctions Protein 1(Fcj1) Protein, His-Tagged
Cat.No. : | RFL2425PF |
Product Overview : | Recombinant Full Length Paracoccidioides brasiliensis Formation of crista junctions protein 1(FCJ1) Protein (C1G784) (45-641aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Paracoccidioides brasiliensis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (45-641) |
Form : | Lyophilized powder |
AA Sequence : | PASPSTGSTLKPETVLVAPVSPLRQGQSSPGSAAPAPEPAAAPPPSPPPPPPAPKTGRLR KFLLYLFLTTGLAYAGGVWYSLRSDNFYDFFTEYAPYGENAVIYLEERDFRNRFPNATKK NNRRAVAPRDEGAQVTIPGGSGLSWKVAEEQQEGSDISKKGPHMSAVDNNKATKDTKTVE KTKGGVTSKSPAQKEEAVKTKPAPEGVKTQPAKVAETPREPAIPAITTIDHLVLNTEDEP VVQDLVKVFNDIITVISADAPSSFSGPVAKAKEELEKIGKRILALKSDAQASAQKEINDA HASFDKSAANLIRHIDEMRAEDATKFREEFEAERERIAQSYQEKINTELQRAHEVAEQRL RNELVEQAIELNRKFLSDVKNLVEHERESRLSKLAELVSSVAELERLTAGWSNVIDINLK TQQLQVAVDAVRTTLENSNVPRPFIRELAAVKELASNDEVVSAAIDSISPVAYQRGIPSS AHLVDRFRRVATEVRKASLLPENAGITSHAASFVLNKVMLKKHGSPAGNDVESTLTRAEN FLEEGNLDEAAREMNSLKGWAKLLSKDWLADVRRVLEVKQALEVIETEARLRCLQVE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MIC60 |
Synonyms | MIC60; PADG_03039; MICOS complex subunit MIC60; Mitofilin |
UniProt ID | C1G784 |
◆ Recombinant Proteins | ||
CWC27-4090M | Recombinant Mouse CWC27 Protein | +Inquiry |
NEC-007M | Active Recombinant Mouse NEC protein, His-tagged | +Inquiry |
LEP-06B | Recombinant Bovine Leptin | +Inquiry |
KCNJ6-259H | Recombinant Human KCNJ6, GST-tagged | +Inquiry |
ANKRD65-3487H | Recombinant Human ANKRD65, His-tagged | +Inquiry |
◆ Native Proteins | ||
HP-146R | Native Rabbit Hemoglobin | +Inquiry |
Neuraminidase-013C | Active Native Clostridium perfringens Neuraminidase Agarose, Type VI-A | +Inquiry |
Thrombin-23B | Native Bovine Thrombin | +Inquiry |
Lectin-1781G | Active Native Griffonia Simplicifolia Lectin I Protein | +Inquiry |
F12-13H | Native Human Factor beta-XIIa, Biotin Labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
NFAM1-3860HCL | Recombinant Human NFAM1 293 Cell Lysate | +Inquiry |
CTSZ-1603HCL | Recombinant Human CTSZ cell lysate | +Inquiry |
FARSB-6325HCL | Recombinant Human FARSB 293 Cell Lysate | +Inquiry |
NR0B1-3723HCL | Recombinant Human NR0B1 293 Cell Lysate | +Inquiry |
NDFIP1-3935HCL | Recombinant Human NDFIP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MIC60 Products
Required fields are marked with *
My Review for All MIC60 Products
Required fields are marked with *
0
Inquiry Basket