Recombinant Full Length Phaeosphaeria Nodorum Formation Of Crista Junctions Protein 1(Fcj1) Protein, His-Tagged
Cat.No. : | RFL27894PF |
Product Overview : | Recombinant Full Length Phaeosphaeria nodorum Formation of crista junctions protein 1(FCJ1) Protein (Q0V4H8) (32-621aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Phaeosphaeria nodorum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (32-621) |
Form : | Lyophilized powder |
AA Sequence : | ADNKNLGETAVPNPAPTVTPSSTEKATIPSSDIPKPPPAPETAGASRSAPTIQPATTPPT GPGSASIAPDPKQPKPKKKGRIRRLLFWLTILSGLGYAGGVWYSLVSDNFHDFFTEYVPY GEDAVAYFEEREFRKRVPWPCWDSPRLQPQNLVRRTSSSILRPQWAEWRVLPTRATATSG TKGPHTIANVQEKKQEAAQTATVVKEEAAAPAPAKPVNHLDHLAVPDANDAVVQDVVKIV NDIITVINADSAHDGKYNSALDKAKSELGRVVSDINLMKANLRKESEEKVKSAHDEFEQA AKELVQRLDHQMQAQEAHWKEEFENERERLSQTYKDRLRSELEAAEKVYEQKTKNELLQQ SIHLQKSFTASVRERVEAERDGRLGKLNELSSSVHELEKLTAEWNSVVDANLKTQHLVVA VEAVKSALETQATPKPFVTELAALKEIAADDPVVSAAIASINPAAYQRGIPSPALLIDRF RRVAAEVRKAALLPEDAGVASHIASLAMSKVLFKKSGLAVGQDVEAVLARTEVLLEEGDL DAAAREMNGLQGWAKVLSKDWLGECRRVLEVRQALDVIATEARLNSLLVD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MIC60 |
Synonyms | MIC60; SNOG_01086; MICOS complex subunit MIC60; Mitofilin |
UniProt ID | Q0V4H8 |
◆ Recombinant Proteins | ||
KRAS-4378H | Recombinant Human KRAS Protein (Thr2-Cys184), N-His tagged | +Inquiry |
TOP1MT-3350H | Recombinant Human TOP1MT, GST-tagged | +Inquiry |
SAOUHSC-02862-1113S | Recombinant Staphylococcus aureus subsp. aureus NCTC 8325 SAOUHSC_02862 protein, His-tagged | +Inquiry |
UBXN7-4910H | Recombinant Human UBXN7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL27341SF | Recombinant Full Length Staphylococcus Epidermidis Sensor Protein Kinase Walk(Walk) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
VTN -51P | Native Porcine multimeric vitronectin | +Inquiry |
NEFM-179B | Native bovine NEFM | +Inquiry |
GCKR-8324S | Native S. cerevisiae GCKR | +Inquiry |
LYZ-27700TH | Native Human LYZ | +Inquiry |
F2-277B | Active Native Bovine α-Thrombin-BFPRck (Biotin) | +Inquiry |
◆ Cell & Tissue Lysates | ||
NLRP5-3797HCL | Recombinant Human NLRP5 293 Cell Lysate | +Inquiry |
SUV420H1-1332HCL | Recombinant Human SUV420H1 293 Cell Lysate | +Inquiry |
RPL12-2227HCL | Recombinant Human RPL12 293 Cell Lysate | +Inquiry |
CMTM8-190HCL | Recombinant Human CMTM8 lysate | +Inquiry |
NEUROD4-3866HCL | Recombinant Human NEUROD4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MIC60 Products
Required fields are marked with *
My Review for All MIC60 Products
Required fields are marked with *
0
Inquiry Basket