Recombinant Full Length Debaryomyces Hansenii Formation Of Crista Junctions Protein 1(Fcj1) Protein, His-Tagged
Cat.No. : | RFL35026DF |
Product Overview : | Recombinant Full Length Debaryomyces hansenii Formation of crista junctions protein 1(FCJ1) Protein (Q6BXM9) (29-578aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Debaryomyces hansenii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (29-578) |
Form : | Lyophilized powder |
AA Sequence : | NVPNNQRTPPPAVRPPTSPIIVTEGGPKGGSQKQKKKFSFAGFLFKTAFWASVVYGGTLF VATKNDKVMDFIMDKQPPYYEELLNVIEHGSIEDLKRQLRDTQHKISNFDFKLPSKAKID EFTHELESRGENLIEETKRKLGTSTGAKPRQAIPEGNSAPTPAEQLQKPVETIHKTVDHL PLIQLDKGIASSVDSSIKSTIKSFNDLILSIDAGSQSGNESLMREITENVSKLSSKLNKL TSSFDEELSSKLKISQSELLSSYTKKELELTENLLHQFHHEKAQMEKKLGSRLDQEIEAT KQTISQAAVNAVSMMRVEQTKNFEKLIKGKIDQERDGRLANLDKLNSRITELENFSTSLE SQLVANHQKSLIQQSLTKLKSLLLGASSEQEKPRLISPYVDNLAKVSHESKDELIALALQ DLQPLLSRESTQSILSTPQLLTRWEQLVPELRSASLLPPNAGLLGHLSSMLFSKLLFPVK GAKPDGKDIESVIGRVESSLARGELDVAVEEAANLKGWSRKLADDWVKEGRKKLEIEFLM KIIDAESKIL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MIC60 |
Synonyms | MIC60; DEHA2B01716g; MICOS complex subunit MIC60; Mitofilin |
UniProt ID | Q6BXM9 |
◆ Recombinant Proteins | ||
ACSBG1-1221M | Recombinant Mouse ACSBG1 Protein | +Inquiry |
PLEKHF1-6834M | Recombinant Mouse PLEKHF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
APOBEC1-1785M | Recombinant Mouse APOBEC1 Protein | +Inquiry |
Acvr1b-288M | Recombinant Mouse Acvr1b Protein, His-tagged | +Inquiry |
Mmp2-246R | Recombinant Rat Mmp2 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
FSH-35H | Native Human FSH | +Inquiry |
ApoE-3560H | Native Human ApoE | +Inquiry |
BSA-01 | Native Bovine Serum Albumin | +Inquiry |
HBB-001H | Native Human Hemoglobin S, Ferrous Stabilized | +Inquiry |
VTN -33B | Native Bovine multimeric vitronectin | +Inquiry |
◆ Cell & Tissue Lysates | ||
HIRA-791HCL | Recombinant Human HIRA cell lysate | +Inquiry |
IGHD-840HCL | Recombinant Human IGHD cell lysate | +Inquiry |
AMN1-8879HCL | Recombinant Human AMN1 293 Cell Lysate | +Inquiry |
MTMR2-4074HCL | Recombinant Human MTMR2 293 Cell Lysate | +Inquiry |
STK39-1398HCL | Recombinant Human STK39 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MIC60 Products
Required fields are marked with *
My Review for All MIC60 Products
Required fields are marked with *
0
Inquiry Basket