Recombinant Full Length Photobacterium Profundum Apolipoprotein N-Acyltransferase(Lnt) Protein, His-Tagged
Cat.No. : | RFL7431PF |
Product Overview : | Recombinant Full Length Photobacterium profundum Apolipoprotein N-acyltransferase(lnt) Protein (Q6LNA1) (1-517aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Photobacterium profundum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-517) |
Form : | Lyophilized powder |
AA Sequence : | MTKKSFFSLGRLLLAVPAGAIATLTFAPYNYWLLAPVSIALLLWLLQAQTVKRSGLIGFL WGLGLFGTGISWVHVSIDTFGGMPKIASVFLMSSLISYLALYPAAFGALFNRFNRGRPFH QLMLSGPVIWLLLDWVRGWALTGFPWLWMGYGQIDSPLASLAPILGVEGITLALVLISGA LVASVVYRNWKPLMVPVLIMALTWAANTVSWVVPDPTKNLDVALIQGNVPQELKWLPSER WPTLMKYTDLTRENWDADIIVWPEAAIPALEAHLPTFLQNLDSAARNNNSTVITGVLDQK EDGQYFNNILTLGKNAYGPYQYDKATRYSKHHLLPFGEFVPFGDLLRPIAPLFNLPMSSF SRGDLVQPNLEASGYSIAPALCYEVAFSEQVRKNVNIDTDLLLTLSNDAWFGTSIGPFQH MEIAQMRALELGKPLIRSTNTGITAVVDHTGQIIKQIPQFETAVLRATITPTEGLTPYTT LGSWPLYFYSLWSLTLSMILIRRRSGRFRDTRPVETE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lnt |
Synonyms | lnt; PBPRA2882; Apolipoprotein N-acyltransferase; ALP N-acyltransferase |
UniProt ID | Q6LNA1 |
◆ Native Proteins | ||
PGA-130H | Active Native Human Pepsinogen I | +Inquiry |
ALB-584P | Native Guinea Pig ALB protein | +Inquiry |
FGG-53S | Native Sheep Fibrinogen | +Inquiry |
PLG-30879TH | Native Human PLG | +Inquiry |
CAT-1646H | Native Human Catalase Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Adipose-4R | Rat Adipose Membrane Lysate | +Inquiry |
EPHA4-1446RCL | Recombinant Rat EPHA4 cell lysate | +Inquiry |
NXT1-3618HCL | Recombinant Human NXT1 293 Cell Lysate | +Inquiry |
SFTPD-2675MCL | Recombinant Mouse SFTPD cell lysate | +Inquiry |
ZNF23-114HCL | Recombinant Human ZNF23 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lnt Products
Required fields are marked with *
My Review for All lnt Products
Required fields are marked with *
0
Inquiry Basket