Recombinant Full Length Pseudomonas Aeruginosa Apolipoprotein N-Acyltransferase(Lnt) Protein, His-Tagged
Cat.No. : | RFL17592PF |
Product Overview : | Recombinant Full Length Pseudomonas aeruginosa Apolipoprotein N-acyltransferase(lnt) Protein (A6V0C5) (1-511aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pseudomonas aeruginosa |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-511) |
Form : | Lyophilized powder |
AA Sequence : | MRWISRPGWPGHLLALAAGALTPLALAPFDYWPLAILSIALLYLGLRGLPARAALWRGWW YGFGAFGAGTSWIYVSIHDYGAASVPLASFLMLGFTAGVAFFFALPAWLWARCLRRDNAP LGDALAFAALWLALELFRSWFLTGFPWLYAGYSQLQGPLAGLVPVGGVWLSSFVIALSAA LLVNLPRLFPHGASLLLALVLLLGPWAAGLYLKGHAWTHSAGEPLKVVAIQGNIAQELKW DPTQVRAQLDLYRDLSLPQQDVDLIVWPETAVPILKDMASGYLGAMGQVAADKKAALITG VPVRERLADGNSRYFNGITVVGEGAGTYLKQKLVPFGEYVPLQDLLRGLIAFFDLPMSDF ARGPADQALLKAKGYEIAPYICYEVVYPEFAAALAAQSQVLLTVSNDTWFGTSIGPLQHL QMAQMRALESGRWMIRATNNGVTGLIDPYGRIVKQIPQFQQGILRGEVIPMQGLTPYLQY RVWPLAGLAGVLLLWALLGRRLRPQERRLFG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lnt |
Synonyms | lnt; PSPA7_1124; Apolipoprotein N-acyltransferase; ALP N-acyltransferase |
UniProt ID | A6V0C5 |
◆ Recombinant Proteins | ||
LIN7C-1381Z | Recombinant Zebrafish LIN7C | +Inquiry |
PTPRZ1-8109H | Recombinant Human PTPRZ1 protein, His & T7-tagged | +Inquiry |
C8B-6786H | Recombinant Human C8B protein, His & T7-tagged | +Inquiry |
PLCB1-3461R | Recombinant Rhesus monkey PLCB1 Protein, His-tagged | +Inquiry |
TRIM35-9604M | Recombinant Mouse TRIM35 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
IgM-235H | Native Human Immunoglobulin M (IgM) | +Inquiry |
Lectin-1803L | Active Native Lycopersicon Esculentum Lectin Protein, DyLight 594 labeled | +Inquiry |
Cyfra-21-1-01H | Native Human MCF-7 Cell Cyfra-21-1 Antigen | +Inquiry |
C2-98H | Active Native Human C2 Protein | +Inquiry |
APOB-1H | Native Human Apolipoprotein B | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADORA1-9006HCL | Recombinant Human ADORA1 293 Cell Lysate | +Inquiry |
LILRA5-1384RCL | Recombinant Rat LILRA5 cell lysate | +Inquiry |
SRP9-1476HCL | Recombinant Human SRP9 293 Cell Lysate | +Inquiry |
MRPL48-4161HCL | Recombinant Human MRPL48 293 Cell Lysate | +Inquiry |
ZNF200-125HCL | Recombinant Human ZNF200 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lnt Products
Required fields are marked with *
My Review for All lnt Products
Required fields are marked with *
0
Inquiry Basket