Recombinant Full Length Agrobacterium Tumefaciens Apolipoprotein N-Acyltransferase(Lnt) Protein, His-Tagged
Cat.No. : | RFL173AF |
Product Overview : | Recombinant Full Length Agrobacterium tumefaciens Apolipoprotein N-acyltransferase(lnt) Protein (Q8UID7) (1-529aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Agrobacterium Fabrum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-529) |
Form : | Lyophilized powder |
AA Sequence : | MERLAGRVMLAGGMSRAVMAIAAGAVGALALPPFGFFAALFFSFTLLVWLVDGCTGKPGG GLFSRILPAFGIGWCFGFGYFVAGLWWLGNALLLEADEFAWALPLAILGLPALLALFYGF AVAAANLLWSDGLGRIAALAAAFGVSEWLRSFLATGFPWNAIGYGIMPIPIMMQSAHLLG LLSITTLAVFIFASPALIGTKKGMGPGLALAGLLLAAHFGYGFYRLQTPAETPADALTVR IVQPAIDQSRKMLNTDRAEIFAEHLRLSALPPGEGKKRPDIIVWPETSVPFILTQNPDAL AEIASTLEDGQVLFTGAVRMEDQGAGRPPRYYNSVYAIDSQGEIIGATDKVHLTPFGEYV PFEGILREFGIDNVIALPGGFSAASSRTPLTLPSGKTFYPLICYEIIFPGEMTPGLQGAA AILNVTNDGWFGDTPGPYQHFLQARVRAVETGVPVIRGANTGISAVIDPYGRIIAGLDYG RVGILDATLSGGSNDAFTYDTHRTYFWLIFSILMIVAVFPALSFARRQN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lnt |
Synonyms | lnt; Atu0360; AGR_C_629; Apolipoprotein N-acyltransferase; ALP N-acyltransferase |
UniProt ID | Q8UID7 |
◆ Recombinant Proteins | ||
Nkiras2-4422M | Recombinant Mouse Nkiras2 Protein, Myc/DDK-tagged | +Inquiry |
ATG3-844R | Recombinant Rat ATG3 Protein | +Inquiry |
C1D-5198H | Recombinant Human C1D protein, GST-tagged | +Inquiry |
HOXD13A-8781Z | Recombinant Zebrafish HOXD13A | +Inquiry |
TMEM130-301292H | Recombinant Human TMEM130 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
C9-58H | Native Human Complement C9 | +Inquiry |
GSN-876P | Active Native Porcine GSN Protein | +Inquiry |
Ferritin-179H | Native Human Ferritin | +Inquiry |
Nppb-5459R | Native Rat Natriuretic Peptide B | +Inquiry |
PALB-134P | Native Pigeon Prealbumin | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABHD14A-9137HCL | Recombinant Human ABHD14A 293 Cell Lysate | +Inquiry |
STXBP4-1719HCL | Recombinant Human STXBP4 cell lysate | +Inquiry |
L3MBTL3-4833HCL | Recombinant Human L3MBTL3 293 Cell Lysate | +Inquiry |
ZFP3-1976HCL | Recombinant Human ZFP3 cell lysate | +Inquiry |
SNRPG-1611HCL | Recombinant Human SNRPG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lnt Products
Required fields are marked with *
My Review for All lnt Products
Required fields are marked with *
0
Inquiry Basket