Recombinant Full Length Rhizobium Etli Apolipoprotein N-Acyltransferase(Lnt) Protein, His-Tagged
Cat.No. : | RFL22723RF |
Product Overview : | Recombinant Full Length Rhizobium etli Apolipoprotein N-acyltransferase(lnt) Protein (B3PZB2) (1-534aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhizobium etli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-534) |
Form : | Lyophilized powder |
AA Sequence : | MERLADRVILVWGFKRSLLAIGAGAFAVLALPPFGFFAAMFLSFTLLVWLIDGAAASPES GLIGRLWPAFAVGWLFGFGYFVAGLWWLGHALLVDSEEFAWALPLAILGLPACLAIFYGL AVALARIFWSDGMGRIAALAAGFGLMEWLRSVILTGFPWNAIGYGLMPVPLMMQSAHVIG AMGVTALAVFVFSAPALFGTRQGARTGVALAVLLFAAHLGYGAYALYLAPRPAPLPEDKR PVVRLVQPDIDQAAKMDNDADRNAIFETHLKLSAEAPRNGGRKPNIIVWPETSIPFILTD NQDALTRIADTLDDDQILIAGAVRAEEMGPGTPVRYYNSIYVIDGRGQIIAASDKVHLVP FGEYLPLEELLTELGIQNVVEVPGGFSAAASRHLLALPGGLNLYPLICYEIIFPDEMTGD IKDANALLNLTNDAWFGMTPGPYQHFLQARVRAVETGLPLIRDANSGISALVNAHGEIIA GLDLGETGFIDATVDSLSEGFGSTYPRQTYFWLTEALLILIALISREGFIFGLN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lnt |
Synonyms | lnt; RHECIAT_CH0000412; Apolipoprotein N-acyltransferase; ALP N-acyltransferase |
UniProt ID | B3PZB2 |
◆ Recombinant Proteins | ||
CNGA4-3647M | Recombinant Mouse CNGA4 Protein | +Inquiry |
TSGA10IP-6315R | Recombinant Rat TSGA10IP Protein | +Inquiry |
MUSK-1434H | Active Recombinant Human MUSK, GST-tagged | +Inquiry |
POLR2I-1847H | Recombinant Human POLR2I, GST-tagged | +Inquiry |
DNAJC17-4641C | Recombinant Chicken DNAJC17 | +Inquiry |
◆ Native Proteins | ||
Collagen Type I & III-04B | Native Bovine Collagen Type I and III Protein | +Inquiry |
GGT1-8130H | Native Human Liver Gamma-Glutamyltransferase | +Inquiry |
Lectin-1818P | Active Native Peanut Lectin Protein | +Inquiry |
CTSS-27405TH | Native Human CTSS | +Inquiry |
FSME-07 | Native FSME (TBE) Virus Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
NGDN-3836HCL | Recombinant Human NGDN 293 Cell Lysate | +Inquiry |
AQP11-8768HCL | Recombinant Human AQP11 293 Cell Lysate | +Inquiry |
PPP3R1-001HCL | Recombinant Human PPP3R1 cell lysate | +Inquiry |
C22orf31-8092HCL | Recombinant Human C22orf31 293 Cell Lysate | +Inquiry |
KLHL12-4913HCL | Recombinant Human KLHL12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lnt Products
Required fields are marked with *
My Review for All lnt Products
Required fields are marked with *
0
Inquiry Basket