Recombinant Full Length Borrelia Burgdorferi Apolipoprotein N-Acyltransferase(Lnt) Protein, His-Tagged
Cat.No. : | RFL22409BF |
Product Overview : | Recombinant Full Length Borrelia burgdorferi Apolipoprotein N-acyltransferase(lnt) Protein (O51253) (1-521aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Borrelia Burgdorferi |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-521) |
Form : | Lyophilized powder |
AA Sequence : | MKTRCFCLAAFSGILTTLAIPNEIKETGYSILGFVAYVPLFIALNKLEDKKALMGLTVFY FIIANSLQNFWLGFFHAFGWITFIGVIIGYIPYSLTLGYFLYYSLKSFKNKTMSITMLFT FYDYSRSIGFLAYPWGLAAFTVNNFNNLIQIADIFGVFFVSFAVYFLNSGIADFLIHKNK TNLLNIAFPTLLITASFTYGMIKKIELKNLLAKEIDSLNIAAIQLNTDPWLPGNDKKGIR DSIEITEQALKENPKIEFVIWSEGVLTYPFSKEDQHFKSSDLHNELKNFIKEHKIPFAIG APSNLDKAIGIQQNSIYMVEPNLNITNIYSKIFLVPFAEKIPFYEYKFVRNFFLKNFRIL GQIEGNKIEILKLKKFKFAPLICYDDAFPELSRFYKTQGANILVNFSNDSWSKTNSAEWQ HFVVAKFRSIENGIKTIRATNSGITATINEYGETIKKLETFKKGYLLSTVKLSPTFTTIY EKIGDSFIHILVMMFLITTLRFQFMEDKNQLLSSSVVKIKV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lnt |
Synonyms | lnt; BB_0237; Apolipoprotein N-acyltransferase; ALP N-acyltransferase |
UniProt ID | O51253 |
◆ Recombinant Proteins | ||
TPT1-4927R | Recombinant Rhesus monkey TPT1 Protein, His-tagged | +Inquiry |
BECN1-161HFL | Active Recombinant Full Length Human BECN1 Protein, C-Flag-tagged | +Inquiry |
GP120-2220H | Recombinant HIV GP120 protein, His-tagged | +Inquiry |
NPC1-4432H | Recombinant Human NPC1 protein, His-Myc-tagged | +Inquiry |
FUNDC1-1586R | Recombinant Rhesus Macaque FUNDC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
pla2-839S | Active Native Snake Phospholipase A2 protein | +Inquiry |
IgGF-330C | Native Chicken IgG Fab | +Inquiry |
MBP-99S | Native Swine MBP | +Inquiry |
LDL-406H | Native Human Low Density Lipoprotein, Acetylated, Biotin labeled | +Inquiry |
TF-8271H | Native Human Serum Transferrin APO (Iron Free) | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSMA7-2776HCL | Recombinant Human PSMA7 293 Cell Lysate | +Inquiry |
CD79B-1827MCL | Recombinant Mouse CD79B cell lysate | +Inquiry |
PI15-3209HCL | Recombinant Human PI15 293 Cell Lysate | +Inquiry |
SNCG-1654HCL | Recombinant Human SNCG cell lysate | +Inquiry |
PRPS1-2820HCL | Recombinant Human PRPS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lnt Products
Required fields are marked with *
My Review for All lnt Products
Required fields are marked with *
0
Inquiry Basket