Recombinant Full Length Chlamydophila Caviae Apolipoprotein N-Acyltransferase(Lnt) Protein, His-Tagged
Cat.No. : | RFL25149CF |
Product Overview : | Recombinant Full Length Chlamydophila caviae Apolipoprotein N-acyltransferase(lnt) Protein (Q824Q5) (1-541aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chlamydophila caviae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-541) |
Form : | Lyophilized powder |
AA Sequence : | MFRILSFLCSWILIAFAQPDMSWFFSLLGSAVGYGLLWYSLEPQKSPKLSWRQLTSLLFL WSVTVYGVHFSWMLSDLYVGKFIYVVWGVLISLLALLFTAFSCLLFFIVRKKHTKILWCL PGLWVAVEMVRFYFLCSGMSLDYLGWPITANAYGRQFGGFFGWAGESFILVATGISFYQV LLRKCFSRYVWLGCLLFPYILGGVHYEYLKNTFSKEENLRVAVIQPASSMLLEGPWSGSP AMAWQRLVSLSSIVRKPVDLLIFPEVSVPFGRDRKVYPYDDSQVILSPLTHFKHQDELLA NVDWMQALSNHFNCPILMGLERWEELDSKLHLYNSAECISQHGELIGYDKRILVPGGEYI PGGKIGWSVCKKYFPEYALSCQRIPGARSGVIEVENLPKMGVSICYEETFGMLLRNYKRE GAKLLVNLTNDGWYPSSRLPQVHFYHGILRNQELGMPCVRSCHTGITVAADALGRVIKML PYETRYRKASPGVLQVSLPMQNYPTLYAFWGDFPMIFLSLLSIGCIGCYFGYRLLAKKEK A |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lnt |
Synonyms | lnt; CCA_00087; Apolipoprotein N-acyltransferase; ALP N-acyltransferase |
UniProt ID | Q824Q5 |
◆ Native Proteins | ||
IgG-008G | Native Guinea Pig Whole Molecule IgG, Biotin Conjugated | +Inquiry |
LOX3-11S | Native Soybeans LOX3 Protein | +Inquiry |
GlycoProtein G-11H | Native HSV-2 GlycoProtein G | +Inquiry |
Tryptase-01H | Active Native Human Tryptase Protein | +Inquiry |
HB-43R | Native Rat Hemoglobin (HB) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNF133-1518HCL | Recombinant Human RNF133 cell lysate | +Inquiry |
SULT1C2-1351HCL | Recombinant Human SULT1C2 293 Cell Lysate | +Inquiry |
ALS2-66HCL | Recombinant Human ALS2 cell lysate | +Inquiry |
DTNBP1-6796HCL | Recombinant Human DTNBP1 293 Cell Lysate | +Inquiry |
Ureter-546H | Human Ureter Membrane Tumor Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All lnt Products
Required fields are marked with *
My Review for All lnt Products
Required fields are marked with *
0
Inquiry Basket