Recombinant Full Length Candida Dubliniensis Formation Of Crista Junctions Protein 1(Fcj1) Protein, His-Tagged
Cat.No. : | RFL20741CF |
Product Overview : | Recombinant Full Length Candida dubliniensis Formation of crista junctions protein 1(FCJ1) Protein (B9WLF1) (18-564aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Candida dubliniensis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (18-564) |
Form : | Lyophilized powder |
AA Sequence : | VSTSTVRFNNAPKVVSPPVPPTVKPQGSEIPPPPPPPPKTKKFSLFGFLFKTTLLATVVY GGTLYAATKNDKVMDFVIDKQLPFHEELIDFIENGSTEDLEEAWENLKSKFTNVKLPTKD DIDELTQKLEHRGEDIIKETKKKIASTHIGHKSGTDLTPAEQLQRGVEIESVKKDFAHLP LIELNSDLGKSVDDTVKQTITSFNNFIQSIDASSLANKDDKLVASVNTSVNQLASRLNSL TKDFDNELQKKLKVSQTELFSSFTRKELELTENLLHQFSTEKQQLESKLNQKLNQEIQAA RAAISQAASNAVAMVRIEQTKNFEKLVSEKLNEERTGRLANLEKLNDRIIELEKFAEGFE TQIVSNHKKAIIHQTVSKLKSLLLAPTAGDKPQPIKPYLDELTKIASDDEVLKLAIKDLS PLVTNESTHSILTNAQLLSRWEQLAPELRSASLLPPNAGLLGHLASIVFSKLLLPVKGIK EDGKDIESVIGRVESSLARGELDIAVEEAANLKGWSRKLANDWVVEGRKRLEIEFLLGLI ESESRII |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MIC60 |
Synonyms | MIC60; CD36_28660; MICOS complex subunit MIC60; Mitofilin |
UniProt ID | B9WLF1 |
◆ Recombinant Proteins | ||
TNFSF11-322HAF647 | Recombinant Human TNFSF11 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
RHOA-27379TH | Recombinant Human RHOA | +Inquiry |
NUP54-4128R | Recombinant Rat NUP54 Protein | +Inquiry |
TXNIP-6032R | Recombinant Rat TXNIP Protein, His (Fc)-Avi-tagged | +Inquiry |
Lrrc6-3839M | Recombinant Mouse Lrrc6 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
Factor XIII-67H | Native Human Factor XIII | +Inquiry |
RNase-43B | Active Native Bovine Ribonuclease | +Inquiry |
PLAU-31689TH | Active Native Human Urokinase protein | +Inquiry |
TG-37P | Native Porcine TG protein | +Inquiry |
Tropomyosin-894R | Native Rabbit Tropomyosin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PCSK9-2775RCL | Recombinant Rhesus PCSK9 cell lysate | +Inquiry |
PRKCE-2857HCL | Recombinant Human PRKCE 293 Cell Lysate | +Inquiry |
KHK-4985HCL | Recombinant Human KHK 293 Cell Lysate | +Inquiry |
KIAA0319L-900HCL | Recombinant Human KIAA0319L cell lysate | +Inquiry |
TRPM8-737HCL | Recombinant Human TRPM8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MIC60 Products
Required fields are marked with *
My Review for All MIC60 Products
Required fields are marked with *
0
Inquiry Basket