Recombinant Full Length Neosartorya Fischeri Formation Of Crista Junctions Protein 1(Fcj1) Protein, His-Tagged
Cat.No. : | RFL27688NF |
Product Overview : | Recombinant Full Length Neosartorya fischeri Formation of crista junctions protein 1(FCJ1) Protein (A1CXH2) (42-624aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Neosartorya fischeri |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (42-624) |
Form : | Lyophilized powder |
AA Sequence : | ADAKPPVTGAPTPASPSSESPIPPESVPKPSPAAEAPPPPPPPPAPARKTGRFRKFLLYL ILTSGFAYGGGIFLALKSDNFHDFFTEYVPYGEDCVLYFEERDFYRRFPNTLRNQNRAPK DEGHTVTIPSKSGLSWKVADEESGADVSQKGPHMSALDNGEKAQLKPGAAKPEEKVAAVE KAKAESAAKEQSSDDKKKVQEEPKKPAAPAVTPIEFATVSEGDEEVVQELVKTFNDIITV IGADENAHKFSGAVNKAKEELRTIGEKIIAIRNEARNAAQEEIKQAHATFDESARELIRR FEEARAHDAAQYREEFEVERERLARAYQEKVNTELQRAQEVAEQRLKNELVEQAIELNRK YLHEVKDLVEREREGRLSKLNELTANVNLLEKLTTDWKEVIDTNLKTQQLQVAVDAVRSV LERSTVPRPFVRELVAVKELAAGDPVVEAAIASINPTAYQRGIPSTSQIIERFRRVADEV RKASLLPEDAGIASHAASLVLSKVMFKKDAVAGSDDVESVLLRTEHLLEEGNLDDAAREM NTLKGWAKILSKDWLSDVRRVLEVKQALEVIETEARLQCLRVE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MIC60 |
Synonyms | MIC60; NFIA_108170; MICOS complex subunit MIC60; Mitofilin |
UniProt ID | A1CXH2 |
◆ Recombinant Proteins | ||
SCO2324-1263S | Recombinant Streptomyces coelicolor A3(2) SCO2324 protein, His-tagged | +Inquiry |
6330403K07Rik-231M | Recombinant Mouse 6330403K07Rik Protein, MYC/DDK-tagged | +Inquiry |
O-518V | Recombinant FMDV O Protein | +Inquiry |
ATP2C1-268H | Recombinant Human ATP2C1 Protein, His-tagged | +Inquiry |
LRRTM3-3146R | Recombinant Rat LRRTM3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
FGA-78H | Active Native Human Fibrinogen (Pg & vWF depleted) | +Inquiry |
C3-02M | Native Monkey C3 Protein | +Inquiry |
Lectin-1850U | Active Native Ulex Europaeus Agglutinin I Protein, Biotinylated | +Inquiry |
IgG-356B | Native Bovine Gamma Globulin Fraction | +Inquiry |
IGHE-214H | Native Human Immunoglobulin E (IgE) | +Inquiry |
◆ Cell & Tissue Lysates | ||
RERGL-638HCL | Recombinant Human RERGL cell lysate | +Inquiry |
HIBADH-785HCL | Recombinant Human HIBADH cell lysate | +Inquiry |
FETUB-2022HCL | Recombinant Human FETUB cell lysate | +Inquiry |
KRTAP5-6-4841HCL | Recombinant Human KRTAP5 293 Cell Lysate | +Inquiry |
POLG2-3047HCL | Recombinant Human POLG2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MIC60 Products
Required fields are marked with *
My Review for All MIC60 Products
Required fields are marked with *
0
Inquiry Basket