Recombinant Full Length Ashbya Gossypii Formation Of Crista Junctions Protein 1(Fcj1) Protein, His-Tagged
Cat.No. : | RFL34377AF |
Product Overview : | Recombinant Full Length Ashbya gossypii Formation of crista junctions protein 1(FCJ1) Protein (Q754G4) (15-496aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ashbya gossypii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (15-496) |
Form : | Lyophilized powder |
AA Sequence : | ASTLPPVPRKKSHGVRRLLAKAVVATSLFYAGGLTLSAYNDKANELFVEHVPFGEELVER WEDWTSLRRPGRRMIDARRVDEISRDFRAAATPEATPVVVRPLVQLQLPELQMQGSSPVL EALVNNVNDVVVALNARALELPEDTASALSSVYGEIVHSIQALNASLDQEFATEVESRTG KAISSVQEQLEVEYKQRELALAEQYIQNFEVFKSQLQKATAEQLETELKAHEQALLARHR NEVAQLSIRQVEEFNKIIEKKLDQERNGRLAKLSELNSAVESLAPVLDRLELRAVKNECV TQLSTLISDIQGKLSRGGDEPLDLSSDLQRLTLLADILPRPKRCCSEGPALLDVAMAELQ AKAQAPVASNEQLYNRWQLLQPELKTTSLLPPNAGFLGHLTAKLFSMLLFTKEGFSTTQD MDAVTARIAENLRLNKLDCALEEAVNMKGWSRKSADAWVDLARRRLEVLTLLDVIEAEVK TL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MIC60 |
Synonyms | MIC60; AFR106C; MICOS complex subunit MIC60; Mitofilin |
UniProt ID | Q754G4 |
◆ Recombinant Proteins | ||
HNF4A-2893H | Recombinant Human HNF4A protein, His-tagged | +Inquiry |
NUDT5-10976M | Recombinant Mouse NUDT5 Protein | +Inquiry |
RFL29213RF | Recombinant Full Length Roseiflexus Castenholzii Atp Synthase Subunit B(Atpf) Protein, His-Tagged | +Inquiry |
AWAT1-1292H | Recombinant Human AWAT1 | +Inquiry |
ZBTB24-2942Z | Recombinant Zebrafish ZBTB24 | +Inquiry |
◆ Native Proteins | ||
OMD-137C | Native Chicken Ovomucoid | +Inquiry |
Liver-021H | Human Liver Lysate, Total Protein | +Inquiry |
Lectin-1829P | Active Native Pisum Sativum Agglutinin Protein | +Inquiry |
VTN-31736TH | Native Human VTN | +Inquiry |
Lectin-1823P | Active Native Phaseolus Vulgaris Leucoagglutinin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
H293-01HL | Human 293, Transformed Primary Embryonal Kidney lysate | +Inquiry |
GRM8-5731HCL | Recombinant Human GRM8 293 Cell Lysate | +Inquiry |
GLIPR1-2392HCL | Recombinant Human GLIPR1 cell lysate | +Inquiry |
SYMPK-1729HCL | Recombinant Human SYMPK cell lysate | +Inquiry |
HOXC4-5417HCL | Recombinant Human HOXC4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All MIC60 Products
Required fields are marked with *
My Review for All MIC60 Products
Required fields are marked with *
0
Inquiry Basket