Recombinant Full Length Neosartorya Fumigata Formation Of Crista Junctions Protein 1(Fcj1) Protein, His-Tagged
Cat.No. : | RFL781NF |
Product Overview : | Recombinant Full Length Neosartorya fumigata Formation of crista junctions protein 1(fcj1) Protein (B0Y5Z6) (42-624aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Neosartorya fumigata |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (42-624) |
Form : | Lyophilized powder |
AA Sequence : | ADAKPPVTGAPTPASPSSESSIPPETVPKPSPAAEAPLPPPPPPAPARKTGRFRKFLLYL ILTSGFAYGGGIFLALKSDNFHDFFTEYVPYGEDCVLYFEERDFYRRFPNTLRNQNRAPK DEGHTVTIPSKSGLSWKVAEEESGADVSQKGPHMSALDNGDKAQLKPGAAKPEEKVATVE KVKAESAAKEQTAEDKKKVKEEPKKPAAPAVTPIEFATVSEGDEEVVQELVKTFNDIITV IGADENAHKFSGAVNKAKEELRTIGEKIIAIRNEARKAAQEEIKQAHATFDESARELIRR FEEARAHDAAQYREEFEAERERLARAYQEKVNTELQRAQEVAEQRLKNELVEQAIELNRK YLHEVKDLVEREREGRLSKLNELTANVNLLEKLTTDWKEVIDTNLKTQQLQVAVDAVRSV LERSTVPRPFVRELVAVKELAAGDPVVEAAIASINPTAYQRGIPSTSQIIERFRRVADEV RKASLLPEDAGIASHAASLVLSKVMFKKDAVAGSDDVESVLLRTEHLLEEGNLDDAAREM NTLKGWAKILSKDWLSDVRRVLEVKQALEVRLGPFTSLFHLYR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mic60 |
Synonyms | mic60; AFUB_065130; MICOS complex subunit mic60; Mitofilin |
UniProt ID | B0Y5Z6 |
◆ Recombinant Proteins | ||
TUBB4B-6364R | Recombinant Rat TUBB4B Protein | +Inquiry |
POLR3G-1731H | Recombinant Human POLR3G | +Inquiry |
RFL14344ZF | Recombinant Full Length Zea Mays Adp,Atp Carrier Protein 1, Mitochondrial(Ant1) Protein, His-Tagged | +Inquiry |
LBR-820Z | Recombinant Zebrafish LBR | +Inquiry |
E2F4-3008H | Recombinant Human E2F4 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
TRPM2-8463H | Native Human TRPM2 | +Inquiry |
CRP-59C | Native Canine C-Reactive Protein | +Inquiry |
PNLIP-1175P | Native Porcine Pancreatic Lipase | +Inquiry |
Lectin-8983P | Active Native Phaseolus vulgaris (red kidney bean) Lectin | +Inquiry |
R-PE-004R | Native Red Fluorescent Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNF-897HCL | Recombinant Human TNF 293 Cell Lysate | +Inquiry |
Adrenal-631B | Bovine Cortex Lysate, Total Protein | +Inquiry |
FUT1-6117HCL | Recombinant Human FUT1 293 Cell Lysate | +Inquiry |
CEACAM7-179HCL | Recombinant Human CEACAM7 lysate | +Inquiry |
HELLS-5589HCL | Recombinant Human HELLS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All mic60 Products
Required fields are marked with *
My Review for All mic60 Products
Required fields are marked with *
0
Inquiry Basket