Recombinant Full Length Scheffersomyces Stipitis Formation Of Crista Junctions Protein 1(Fcj1) Protein, His-Tagged
Cat.No. : | RFL34926SF |
Product Overview : | Recombinant Full Length Scheffersomyces stipitis Formation of crista junctions protein 1(FCJ1) Protein (A3LQS0) (14-548aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Scheffersomyces stipitis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (14-548) |
Form : | Lyophilized powder |
AA Sequence : | SSSVSETGKSSQGQDQKHENYQNHQQSSLAGIVIKSALFATVVYGATMFIATKNDKVMDF VIDQQIPYYEETIDLIENGSYDDLVSAIKAKISSIRLPSKDEITELSHKIEHTSEDLLKE TKRKLESARAEFGSHSTAGSGTSASLPANQLQKHPEIEHVKKEVEHLPAIKLNENVVSYV DASVKATIDSFNDLINSIDVSKVTPTDEGLIKTINEKVSELASKVGALSKKFDDELQSKL KVSQTELLSSYTKKELELTENLLHQFNRERAQLESKLNERLKQEIAATKETISQAAVNAV SMVRIEQTKNFEKLVADKINEERNGKLANLEKLNSRLESLEQFAESLESQVVATQQKSVI QKSLSSLKAVLFVSNPEEKPQSIKPYVDDLFESSPDDEVIQLALGELGPLLSKESTQSIL TTSQLLTRWEQLVPELRSASLLPPNAGLLGHLASIVFSKFLVSVKGDKPDGKDIESVIGR VEASLVRDELDVAVEEVANLKGWTRKLANDWVIEGRKRLEAEYLVELIDAETRIL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MIC60 |
Synonyms | MIC60; PICST_76840; MICOS complex subunit MIC60; Mitofilin |
UniProt ID | A3LQS0 |
◆ Recombinant Proteins | ||
CCNJL-1412M | Recombinant Mouse CCNJL Protein, His (Fc)-Avi-tagged | +Inquiry |
Ifna-189M | Recombinant Murine Interferon Alpha | +Inquiry |
KRT7-2983R | Recombinant Rat KRT7 Protein, His (Fc)-Avi-tagged | +Inquiry |
KYAT1-1012H | Recombinant Human KYAT1 Protein, MYC/DDK-tagged | +Inquiry |
CTSH-1889H | Recombinant Human CTSH Protein (Ala23-Val335), N-His tagged | +Inquiry |
◆ Native Proteins | ||
GG-193R | Native Rat Gamma Globulin protein | +Inquiry |
PLD-19S | Active Native Streptomyces sp. Phospholipase D, Type VII | +Inquiry |
IgE-507H | Native Human IgE protein | +Inquiry |
Complement C1r-45H | Native Human Complement C1r | +Inquiry |
FGF1-26203TH | Native Human FGF1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
LPCAT2-4671HCL | Recombinant Human LPCAT2 293 Cell Lysate | +Inquiry |
TBX15-1204HCL | Recombinant Human TBX15 293 Cell Lysate | +Inquiry |
HeLa-12H | HeLa Cell Nuclear Extract - TNFa Stimulated | +Inquiry |
BTG2-8392HCL | Recombinant Human BTG2 293 Cell Lysate | +Inquiry |
CerebralCortex-424S | Sheep Cerebral Cortex Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MIC60 Products
Required fields are marked with *
My Review for All MIC60 Products
Required fields are marked with *
0
Inquiry Basket