Recombinant Full Length Nectria Haematococca Formation Of Crista Junctions Protein 1(Fcj1) Protein, His-Tagged
Cat.No. : | RFL34523NF |
Product Overview : | Recombinant Full Length Nectria haematococca Formation of crista junctions protein 1(FCJ1) Protein (C7YIH6) (42-633aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Nectria haematococca |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (42-633) |
Form : | Lyophilized powder |
AA Sequence : | AVDKKPESASSPSLPNTQSVASDKIHETTIDDVGETKAATVDAPKTTPPPPPPPPAPKKK GFFRRLRNFVFTLFVLGAVGFAGGVWYSCFSDNFHDFFTGYVPFGEQAVLYLEEMEYKKR FPNSATNAKSRDADGAVRIPAQSGASWRVADGTRRSSAGPVPAKQEEPKAEAPKPKAAEP KPTAKVVEKPAPTPAPAPTPRSESGFKAPEVNEPSRYPPLKPIDLLSLDDAREPVIQDLV HMVNDLILVINADGAHGRYGSSVNKAKNEITKVGGKLKGMKEQFEKKAAGQVRDKIDEFD KAATDLIDRVESAMITQESQWRHEFEEEMKKVRENYEDRVKVLLERERKLNEEKLQNQLL EQALALKKEFVKDVENQVEQERESRLGKLTALSSAVADLEKLTTGWNEVLDTNLQTQQLH VAVEAVRASLEDDHHPRPFIRELVALREIASDDPVVNAAIASVNPTAYQRGISTSSQLID RFRRVANEVRKASLLPDEAGVASHASSWVLSHVMFKKQGLAEGNDVESVLTRTQTYLEEG DLDSAAREMNGLEGWAKTLSKDWLGEVRKVLEVQQALDVIATEARLQSLRVD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MIC60 |
Synonyms | MIC60; NECHADRAFT_75325; MICOS complex subunit MIC60; Mitofilin |
UniProt ID | C7YIH6 |
◆ Recombinant Proteins | ||
GAGE2A-2337H | Recombinant Human GAGE2A, His-tagged | +Inquiry |
Nucb2-1958M | Recombinant Mouse Nucleobindin 2 | +Inquiry |
ZP1-6370R | Recombinant Rat ZP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FBXO5-3957H | Recombinant Human FBXO5 Protein, GST-tagged | +Inquiry |
RFL33564HF | Recombinant Full Length Human Transient Receptor Potential Cation Channel Subfamily V Member 2(Trpv2) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
APOA2-4772H | Native Human Apolipoprotein AII protein | +Inquiry |
C-type lectin like protein-040H | Native Hen C-type lectin like protein Protein | +Inquiry |
Plg-32M | Native Mouse Plg protein | +Inquiry |
sPLA2-60B | Native Bee Venom sPLA2 Protein | +Inquiry |
Lectin-1795A | Active Native Artocarpus integrifolia Jacalin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
VPS41-386HCL | Recombinant Human VPS41 293 Cell Lysate | +Inquiry |
GFRA2-2408MCL | Recombinant Mouse GFRA2 cell lysate | +Inquiry |
ABHD14A-9137HCL | Recombinant Human ABHD14A 293 Cell Lysate | +Inquiry |
CRABP2-7295HCL | Recombinant Human CRABP2 293 Cell Lysate | +Inquiry |
FAM176B-6403HCL | Recombinant Human FAM176B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MIC60 Products
Required fields are marked with *
My Review for All MIC60 Products
Required fields are marked with *
0
Inquiry Basket