Recombinant Full Length Neurospora Crassa Formation Of Crista Junctions Protein 1(Fcj1) Protein, His-Tagged
Cat.No. : | RFL19038NF |
Product Overview : | Recombinant Full Length Neurospora crassa Formation of crista junctions protein 1(fcj1) Protein (Q7SFD8) (49-672aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Neurospora Crassa |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (49-672) |
Form : | Lyophilized powder |
AA Sequence : | VPEPSQPAVLPASETLTSPSTPPPASPQVEPTSTVPPETTPLTPPTPEATVIPPVAEEPV VPPTLPTPRKKKGFFRRLRNFFLSLTILGAIAFGGGVYYSRINDAFHDFFTEYIPYGEQA VLYLEELDFKKRFPDVVSRVTGRPRDSGEQVKVPAQSGASWRVASGGEPAGRQSSSIKKA GAAAQDAVPKSEPAVVAAAKEDTAELPKTEATTTATPAEPAPAPAATDASGTPVKKPFKA PEVDEPSRWPPASPIDPLTVNGATDPIVQDLVKMLNDVITVINHDNANEKYAPTICKAKN ELSKVADKINEMKAKVEADAAKQVKARVDGFDKAANELVSRVESAMAAQEAAWRREFEEE ITRLKKSYDEKVHLIQDREHQIAEEKLNNRLLEQAIQLQRQFTENIKKHVEQERDGRLGK LNELHKAVAELERLTSGLNEVVDTNLRTQQLHVAVDAVRASLEDAHHPRPFIKELVALKE IAADDPVVDAAIASINPTAYQRGIPTTAELIDRFRRVATEVRKASLLPEDAGVASHASSY VLSKLMFKKEGLAAGDDVESILTRTQTYLEEGDLDNAAREMNGLKGWAKTLSRDWLGEVR KVLEVQQALDVIQAEARLQSLRVE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mic60 |
Synonyms | mic60; B13C5.200; NCU00894; MICOS complex subunit mic60; Mitofilin |
UniProt ID | Q7SFD8 |
◆ Native Proteins | ||
CT-34 | Native Chlamydia trachomatis Antigen | +Inquiry |
TF-002H | Native Human TF Protein, Rhodamine Conjugated | +Inquiry |
SERPINF2-5338H | Active Native Human SERPINF2 Protein | +Inquiry |
Lectin-1756C | Active Native Canavalia ensiformis Concanavalin A Protein, Agarose bound | +Inquiry |
Collagen-319H | Native Human Collagen Type II | +Inquiry |
◆ Cell & Tissue Lysates | ||
SCGB1A1-1891HCL | Recombinant Human SCGB1A1 cell lysate | +Inquiry |
KDM8-5102HCL | Recombinant Human JMJD5 293 Cell Lysate | +Inquiry |
GSTK1-5714HCL | Recombinant Human GSTK1 293 Cell Lysate | +Inquiry |
CCDC82-7746HCL | Recombinant Human CCDC82 293 Cell Lysate | +Inquiry |
KCTD7-895HCL | Recombinant Human KCTD7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All mic60 Products
Required fields are marked with *
My Review for All mic60 Products
Required fields are marked with *
0
Inquiry Basket