Recombinant Full Length Aspergillus Niger Formation Of Crista Junctions Protein 1(Fcj1) Protein, His-Tagged
Cat.No. : | RFL7707AF |
Product Overview : | Recombinant Full Length Aspergillus niger Formation of crista junctions protein 1(fcj1) Protein (A2QI68) (48-631aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Aspergillus Niger |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (48-631) |
Form : | Lyophilized powder |
AA Sequence : | ADIKPPTTAAPTPATPSSESAVPPETVPKPSPAGQESTLPPSTPPTPAPKGGRFRRFLLY LLLTSGFAYGGGVFLALKFDNFHDFFTEYIPYGEESVLYFEERDFYRRFPNTLRNQNRLN PTPRDEGNKITIPSKSGLTSKVAEEEISGADVSQKGPHMSATPAQKSSEAQTKPAAAKPE DKTTAVVKAKEDKAAKEAEKKEEPRQPAIPAVTPLEFAQVNEGDEAIVQELVKTFNDMIT VISADENSGKYSQPVAKAKEELQKVGEKIIAVREEARRAAQEEIQQAHATFDESARELIR RFDEMRAADAAQYREEFEAEREKLAHAYQEKIRTELQRAQEVAEQRLKNELVEQAIELNR KYLHEVKELVEREREGRLSKLNELTANVSELEKLTSGWREVIDSNLRTQQLQVAVDAVRS VVDRSAVPRPFVRELVAVKELAAEDPVVEAAISSINPAAYQRGIPSTSQIIERFRRVADE VRKASLLPEDAGIASHAASVVLSKVMFKKDAVAGSDDVESVLYRTESLLEEGNLDAAARE MNSLSGWAKILSKDWLVDVRRVLEVKQALEVIETEARLQCLRVE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mic60 |
Synonyms | mic60; An04g02460; MICOS complex subunit mic60; Mitofilin |
UniProt ID | A2QI68 |
◆ Recombinant Proteins | ||
NFIL3-3014R | Recombinant Rhesus monkey NFIL3 Protein, His-tagged | +Inquiry |
PTPRH-3117H | Recombinant Human PTPRH Protein, MYC/DDK-tagged | +Inquiry |
FSHB-129H | Recombinant Human Follicle Stimulating Hormone, Beta Polypeptide | +Inquiry |
TRPC4-1160HFL | Recombinant Human TRPC4 protein, His&Flag-tagged | +Inquiry |
UCMA-2511H | Recombinant Human UCMA protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
FSME-07 | Native FSME (TBE) Virus Antigen | +Inquiry |
PYGB-03H | Native Human PYGB Protein | +Inquiry |
AFP-3017H | Native Human fetal cord serum | +Inquiry |
Fibrinogen-69C | Active Native Canine Fibrinogen | +Inquiry |
cpe-001C | Active Native C. perfringens Enterotoxin | +Inquiry |
◆ Cell & Tissue Lysates | ||
Lung-322R | Rhesus monkey Lung Membrane Lysate | +Inquiry |
IL9-618HCL | Recombinant Human IL9 cell lysate | +Inquiry |
CPED1-129HCL | Recombinant Human CPED1 lysate | +Inquiry |
CD86-1013CCL | Recombinant Cynomolgus CD86 cell lysate | +Inquiry |
Brain-749B | Bovine Brain Membrane Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All mic60 Products
Required fields are marked with *
My Review for All mic60 Products
Required fields are marked with *
0
Inquiry Basket