Recombinant Full Length Saccharomyces Cerevisiae Formation Of Crista Junctions Protein 1(Fcj1) Protein, His-Tagged
Cat.No. : | RFL6560SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Formation of crista junctions protein 1(FCJ1) Protein (B5VMG3) (17-539aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (17-539) |
Form : | Lyophilized powder |
AA Sequence : | ASINTGTTVASKKASHKFRNTFWTIALSATAFYAGGIIYSQKNDKFGDFFSNNVPFAEDL LETYEHYHDRPTLFLEDSWDGLKAKSNDLLSGLTGSSQTRRSNRENIEVKKILSLEPLNI ETENSDPQLKEIIGSLNDLINSLNDSNLSIPESEFNSIKKSNQNMLTNLSQLNETLKEAL SNYMIQRTSEVITELNTQYENSKREFEKNLQKNLLQEVDEFKENLTKQKDKELEEKLKAN EELLQAKHANEVGLLSITQVKEFNKIIKDKIEKERNGRLAHLEEINSEVNDLSKSIDRSS KILSKNEALVQLTFQVDEIKSRINNNNLPDVNIDKELSRLKLLSNLLSTFNKKSCCDDGD CCSCKKGNKNEGKEGKISCKCKPKTNPPSLLSVVYDELESTCSGKKILSNEQIYNRWNLL ADDFKTASLLPPNSGILGQLTAKVFSLFLFTKTGNPSNATDFDSVYARVGDNLRVSNLND AVEEVVSLKGWPHKVCESWIEDARRKLEVQRLVEILDCEIRTL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MIC60 |
Synonyms | MIC60; AWRI1631_112380; MICOS complex subunit MIC60; Mitofilin |
UniProt ID | B5VMG3 |
◆ Recombinant Proteins | ||
SH3BP5-1333H | Recombinant Human SH3BP5 Protein, DDK-tagged | +Inquiry |
PPPDE1-3397R | Recombinant Rhesus Macaque PPPDE1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ptar1-5211M | Recombinant Mouse Ptar1 Protein, Myc/DDK-tagged | +Inquiry |
GPT-33H | Active Recombinant Human GPT | +Inquiry |
Sars2-2043M | Recombinant Mouse Sars2 Protein, His&GST-tagged | +Inquiry |
◆ Native Proteins | ||
Fixa-278B | Active Native Bovine Factor Ixa | +Inquiry |
APOE-5336H | Native Human Apolipoprotein E | +Inquiry |
Lectin-1720P | Native Peanut Lectin, Biotin conjugated | +Inquiry |
TIMP1-30840TH | Native Human TIMP1 | +Inquiry |
PLAT-29690TH | Native Human Human SERPINE1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SHC3-1602HCL | Recombinant Human SHC3 cell lysate | +Inquiry |
RGS2-2378HCL | Recombinant Human RGS2 293 Cell Lysate | +Inquiry |
TPD52L1-1813HCL | Recombinant Human TPD52L1 cell lysate | +Inquiry |
PCNA-500HCL | Recombinant Human PCNA cell lysate | +Inquiry |
PDE6A-3347HCL | Recombinant Human PDE6A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All MIC60 Products
Required fields are marked with *
My Review for All MIC60 Products
Required fields are marked with *
0
Inquiry Basket