Recombinant Full Length Methylococcus Capsulatus Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL18272MF |
Product Overview : | Recombinant Full Length Methylococcus capsulatus Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q60AA3) (1-601aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Methylococcus capsulatus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-601) |
Form : | Lyophilized powder |
AA Sequence : | MKHSASESKPLSSGLAIYRRLLRYGFPYWRSFCVAVVAMIAYAAITPFFAKLIQPLIDGS FIDNDPTVLRQVSLMLIGLSVLRGIAGFLSEYCSGSVGRRVIADLRRDIFDQLLNLPCSF YDNASGGQLLSKLLYNTEQVSASLQQGIITCIREGFTVIGLMALMVYQNPVLSLVFLVLG PVLGLSVRFVSKRFRRLSMRIQESMGKVSHVTQEVIDAQRIVKVFNGKDYEAAKFATEND RNQKRQMKLIATDALGGGVIHLISVAGVAGILYVVSLDSVRQTITPGSLMAFIAAMAMML SPIRRLSQVVSVMQRGIAAGDSIFAMLDLPRERDRGRISLKRARGSIEYRHVSLVYDDRH GAAVDDVSLVIPAGKTVALVGQSGSGKTSLVRLLPRLYEATAGEILIDGHDIRELTLESL RRQIAYVGQEVTLFNDTVASNIAYGCLDRVGLDAVREAARAANALDFIETLPQGFDTLVG QQGIVLSGGQRQRIAIARALLKNAPILILDEATSALDAESERYVQQALEVLMQNRTTLVI AHRLSTIQNADQICVMRGGRIIECGTHAQLMAARGGYADLYAMQFGYSSVPEAVAVHAVR R |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; MCA0964; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q60AA3 |
◆ Recombinant Proteins | ||
S100a6-4566M | Recombinant Mouse S100 Calcium Binding Protein A6 (Calcyclin) | +Inquiry |
MVD-3486R | Recombinant Rat MVD Protein, His (Fc)-Avi-tagged | +Inquiry |
ANKHD1-7881Z | Recombinant Zebrafish ANKHD1 | +Inquiry |
Tetra-Ubiquitin-57H | Recombinant Human Tetra-Ubiquitin Protein (K11-Linked) | +Inquiry |
CPA6-256H | Recombinant Human CPA6 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
KLK3-387H | Native Human Prostate Specific Antigen (PSA), Low pI Isoform (IEF) | +Inquiry |
IBV-06I | Native Influenza B Antigen | +Inquiry |
APOC1-8038H | Native Human ApoLipoprotein CI | +Inquiry |
LHB-840 | Native Luteinizing Hormone, beta Subunit | +Inquiry |
Complement C4b-51H | Native Human Complement C4b | +Inquiry |
◆ Cell & Tissue Lysates | ||
C10orf62-71HCL | Recombinant Human C10orf62 lysate | +Inquiry |
HSPBAP1-5343HCL | Recombinant Human HSPBAP1 293 Cell Lysate | +Inquiry |
SCN2A-2030HCL | Recombinant Human SCN2A 293 Cell Lysate | +Inquiry |
NUP43-3630HCL | Recombinant Human NUP43 293 Cell Lysate | +Inquiry |
NAPB-430HCL | Recombinant Human NAPB lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket