Recombinant Full Length Methylobacillus Flagellatus Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL34878MF |
Product Overview : | Recombinant Full Length Methylobacillus flagellatus Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q1GZI0) (1-583aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Methylobacillus flagellatus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-583) |
Form : | Lyophilized powder |
AA Sequence : | MSKTALGKANASVQSARALYLRLLKYAARYWVAFLISIIALVTFSATNTGFLATIKLVTD AGFVNQDSTKLHLLPFMLFGLLAIRALAGFISNFAMRWVARRVVENLRQDTFRRLMSLPV SFFDAVSAGVVTSKLTYDTEQMAGAATKVAMSAVRDTLTILGMVGYMLYLDWQLTLIFAV VAPAMAWYLKSMTPKLRSSGKAVQQTMGEMTKVIEEAVSGQRMVKIFGGGDYEYQRFTKV AGKNRHMQIRLARFSGLNSMVVELLAGVALALVVFYAVGKFSAGEFAAFIGALLMLIGPV KTLTSLNEELQVGLAAAHSVFELIDSIPEVDEGHEEIGRAEGSIVFENVTLQYPSAQRPA LLDLNFTVKPGEKIALVGRSGGGKTTLVNLLPRFYEVQQGRVLIDGVDVRNMSLKSLRQQ FSLVSQDVILFNDTVFNNIAYGVLRNASEEDVIAAAKAAHAWDFIQQLPNGLQSEIGDRG VRLSGGQRQRLAIARAILKNAPILLLDEATSALDTESERHVQAALDELMQNRTSIVIAHR LSTIENADRIMVMEQGRIIEGGSHEELLALDGHYAKLYRKQFH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; Mfla_2090; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q1GZI0 |
◆ Recombinant Proteins | ||
EPSTI1-5270M | Recombinant Mouse EPSTI1 Protein | +Inquiry |
ABCB8-2464H | Recombinant Human ABCB8 Transmembrane protein, His-SUMO-tagged | +Inquiry |
Tjp3-1725R | Recombinant Rat Tjp3 protein, His & T7-tagged | +Inquiry |
SLC66A2-1963H | Recombinant Human SLC66A2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
fimH-16E | Recombinant E. coli fimH Protein | +Inquiry |
◆ Native Proteins | ||
HSV2-16 | Native Herpes Simplex Virus (HSV) Type 2 Antigen | +Inquiry |
IGHA1-18H | Native Human IgA1 | +Inquiry |
Protein A-01S | Active Native Staphylococcus aureus Protein A | +Inquiry |
CTSD-5325D | Active Native Human CTSD protein | +Inquiry |
TF-323H | Native Human Transferrin Fluorescein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXorf61-7152HCL | Recombinant Human CXorf61 293 Cell Lysate | +Inquiry |
IL18RAP-2602HCL | Recombinant Human IL18RAP cell lysate | +Inquiry |
TPGS2-8223HCL | Recombinant Human C18orf10 293 Cell Lysate | +Inquiry |
Human Adipose-242H | Human Human Adipose Lysate | +Inquiry |
COL23A1-381HCL | Recombinant Human COL23A1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket