Recombinant Full Length Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL3928VF |
Product Overview : | Recombinant Full Length Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q87R16) (1-582aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Vibrio Parahaemolyticus Serotype O3:K6 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-582) |
Form : | Lyophilized powder |
AA Sequence : | MSINTDETTWQTFKRLWQFIRLYKSGLIVAVIALVINAISDTYMISLLKPLLDEGFGNAD SDFLRTLPLIIFVMMFIRGTSGFVSTYCLSWVSGNVVMLVRRMVFNHFMHMPVSYFDKEK TGNLLSRITYDSEQVSAATSQALVSIVREGASIIGLLVLMFYNSWQLSLVLFAVAPVVAW GIGVVSKRFRKISKNMQTMMGNVTASAEQMLKGHKVVLSYGGQDIERQRFDKVSNQMRQQ SMKLVTAQAAANPIIQMIASFAIVAVLYLASIDSIKEQLTPGTFTVVFSAMFGLMRPLKA LTNVTSQFQRGMAASQTLFALIDLEPEKNEGKYTVERAKGDVSVKDVSFTYVGSEKPALE HVSFDIPRGKTVALVGRSGSGKSTIANLFNRFYDVDSGSITLDGRDIRDYELKNLREQFA LVSQNVHLFNDTIANNIAYATEDKYERSDIEHAAKLAHAMEFINKMENGLDTMIGENGAS LSGGQRQRVAIARALLRDAPVLILDEATSALDTESERAIQAALDELQKDKTVLVIAHRLS TIEKADEILVVDDGAIIERGNHADLIAKNGAYAQLHRIQFGE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; VP0982; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q87R16 |
◆ Native Proteins | ||
Tyrosinase-39 | Native Tyrosinase, Enzyme Activity | +Inquiry |
CAT-101B | Active Native Bovine CAT | +Inquiry |
HbA1c-19M | Native Mouse Glycated Hemoglobin A1c (HbA1c) Protein | +Inquiry |
PALB-134P | Native Pigeon Prealbumin | +Inquiry |
acetylated Albumin-007B | Native Bovine acetylated Albumin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MOLT-4-035WCY | Human Acute Lymphoblastic Leukemia MOLT-4 Whole Cell Lysate | +Inquiry |
Lymphoma-333H | Human Lymphoma Membrane Tumor Lysate | +Inquiry |
MKNK2-4302HCL | Recombinant Human MKNK2 293 Cell Lysate | +Inquiry |
DACT3-7083HCL | Recombinant Human DACT3 293 Cell Lysate | +Inquiry |
DEFB104A-6988HCL | Recombinant Human DEFB104A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket