Recombinant Full Length Bordetella Pertussis Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL1263BF |
Product Overview : | Recombinant Full Length Bordetella pertussis Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q7VWD8) (1-623aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bordetella pertussis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-623) |
Form : | Lyophilized powder |
AA Sequence : | MLAWRPGRPDGCQAAGGRRYNPGHDCIKASVSLNSAARNAPAGSQPVKAELWKRVYSRVG SYWKGLVLAVLLMAGAAATQPTLAVIMKPLLDDGFSGAKPHYVWFLPLAVVGLILLRGIC NFFSDYLLAWVANNVLRGIRGEMFERLLGLPDADFKRGDTGRLLNRFTIDAGNVTGYATD VITVLVRETLVVIALIGVLLYMSWALTLIILVMLPVSVGIARAFTRRLRRINRETVNMNA ELTRVVSEGIDGQRVIKLFDGYDAERRRFDFVNSRLRRFAMRSATADAALTPLTQVCISV AVGAVIAVALSQANSGALTVGSFASFMAALAQIFDPIKRLTNLAGKMQKMLVAAESVFTL VDQTPEADAGTRALPEPVRGKVEFRAVSHRFPDADRDTVSAVSFLVEPGQTVALVGRSGS GKTTLVNMLPRFVLPDGGDILFDDVPIQDLTLRSLRSHLSLVSQDVVLFDDTIAANVGYG AGGTVDDARVRDALAAANLLEFVDGLPLGIHTPVGQNAARLSGGQRQRLAIARALIKNAP VLILDEATSALDNESERQVQASLERLMRGRTTLVIAHRLSTVQNADRIIVLDAGKIVEHG PHSELLAANGLYASLYNMQFRED |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; BP2321; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q7VWD8 |
◆ Recombinant Proteins | ||
MAP2K2-968HAF555 | Recombinant Human MAP2K2 Protein, GST-tagged, Alexa Fluor 555 conjugated | +Inquiry |
CYB5R4-2838H | Recombinant Human CYB5R4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FA2H-4375Z | Recombinant Zebrafish FA2H | +Inquiry |
IL8-5434M | Recombinant Macaca mulatta Interleukin 8 | +Inquiry |
RFL25188LF | Recombinant Full Length Leontopithecus Chrysopygus Melanocyte-Stimulating Hormone Receptor(Mc1R) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Collagen-121H | Native Human Collagen Type IV protein | +Inquiry |
CA2-29D | Native Dog Carbonic Anhydrase II (CA2) Protein | +Inquiry |
Ighg2b-162M | Native Mouse Immunoglobulin G2b | +Inquiry |
FGF1-26203TH | Native Human FGF1 | +Inquiry |
BSA-01 | Native Bovine Serum Albumin | +Inquiry |
◆ Cell & Tissue Lysates | ||
ASIC4-9099HCL | Recombinant Human ACCN4 293 Cell Lysate | +Inquiry |
OBP2A-3609HCL | Recombinant Human OBP2A 293 Cell Lysate | +Inquiry |
CASR-7825HCL | Recombinant Human CASR 293 Cell Lysate | +Inquiry |
C7orf31-7968HCL | Recombinant Human C7orf31 293 Cell Lysate | +Inquiry |
MRPL16-4193HCL | Recombinant Human MRPL16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket