Recombinant Full Length Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL33570YF |
Product Overview : | Recombinant Full Length Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q8ZGA9) (1-582aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Yersinia pestis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-582) |
Form : | Lyophilized powder |
AA Sequence : | MMNDKDLSTWQTFRRLWPTISPYKAGLIVAAIALILNAASDTFMLSLLKPLLDDGFGNSN SSILKWMPLAVIGLMVVRGVTGFVSSYCISWVSGKVVMHIRRRLFSHMMGMPVSFFDQQS TGTLLSRITYDSEQVAASSSSALVTVVREGASIIGLFIMMFYYSWQLSLILIVIAPIVSI SIRLVSKRFRNISKNMQNTMGEVTTSAEQMLKGHKEVLIFGGQKVETERFDAVSNRMRQQ GMKLVSASSISDPIIQLIASFALALVLYAASFPSVMETLTAGTITVVFSAMIALMRPLKS LTNVNTQFQRGMAACQTLFSILDMEQEKDEGKLEVERAKGDIEFRHVTFYYPGKDTPALN DINIHLEAGKTVALVGRSGSGKSTIANLLTRFYDVSEGSILLDGHDLRDYRLGALRNQVA LVSQNVHLFNDTVANNIAYARNEQYSRAEIEEAARMAYAMDFINKMEHGLDTVIGENGIM LSGGQRQRIAIARALLRNCPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLS TIEKADEIVVIEDGRIVERGVHAELLVQQGVYAQLNRMQFGQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; YPO1395; y2777; YP_1198; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q8ZGA9 |
◆ Recombinant Proteins | ||
HA-185H | Recombinant Influenza A H1N1 (A/Hawaii/19/2007) HA1 Protein, His-tagged | +Inquiry |
Vangl1-1483M | Recombinant Mouse Vangl1 protein, His & T7-tagged | +Inquiry |
MBD3-2512R | Recombinant Rhesus Macaque MBD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
PCBP4-6534M | Recombinant Mouse PCBP4 Protein, His (Fc)-Avi-tagged | +Inquiry |
C1orf94-45H | Recombinant Human C1orf94 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
KLH-82 | Native Hemocyanin-Keyhole Limpet (KLH) subunits | +Inquiry |
Protease-20S | Active Native Streptomyces griseus Protease | +Inquiry |
Lectin-1866W | Active Native Succinylated Wheat Germ Agglutinin Protein, Fluorescein labeled | +Inquiry |
Lectin-1848S | Active Native Soybean Agglutinin Protein | +Inquiry |
BCC-162B | Native Bovine Cholesterol Concentrate | +Inquiry |
◆ Cell & Tissue Lysates | ||
YWHAZ-229HCL | Recombinant Human YWHAZ 293 Cell Lysate | +Inquiry |
PACSIN3-3472HCL | Recombinant Human PACSIN3 293 Cell Lysate | +Inquiry |
KCNG4-5061HCL | Recombinant Human KCNG4 293 Cell Lysate | +Inquiry |
RASSF8-2494HCL | Recombinant Human RASSF8 293 Cell Lysate | +Inquiry |
RTP4-2116HCL | Recombinant Human RTP4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket