Recombinant Full Length Burkholderia Sp. Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL21251BF |
Product Overview : | Recombinant Full Length Burkholderia sp. Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q39E73) (1-593aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Burkholderia lata |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-593) |
Form : | Lyophilized powder |
AA Sequence : | METQNTLRKPMDGTGTSPVTVLKRLWPYIRPLIGIVVLAVMTMGVVAATEAGIPALLKPL LDHGFGSHGSDSAKWYVPMAVIGLALVRGVSQYASNYLLNYVSNRILLQLRLEMFQRMLH TGASFFQRETASTVINAIVFEVNQILSVLTGVMVTLVRDSLTVIFLLGYLFYLNWRLTLI VAVILPGIGWLVSKINRRLRRLNREHQTLTNELSYIVEETVGGYKVVKVHNGEAYEMDRF TQMSKRLRGYAMRMTISGGLAQPLTQFLASIALAVVITIAVVQSSNDQTTVGGFVAFVTS MLLVISPLKHLIDVNQPLQRGMTAAELIFGLIDEPAEPQGGGRPLAQSRGDIEFRNVTFD YGAAERPTLDRISFKVAPGEMIALAGPSGSGKTTLVNLLPRFFDPTDGAILVDGVPVADY DLHALRSQMAMVSQDVVLFNDTIAANVAYGQTPDRARVQAALEAANLADAVAAMPDGLDT LVGGNGMRLSGGQRQRLAIARAIYKDAPILILDEATSALDSESERHVQAALERLMEGRTT LVIAHRLSTIERADRILVLEAGKIVEEGSHDELLRHGGLYAHLHRIQYQQQAA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; Bcep18194_A5649; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q39E73 |
◆ Native Proteins | ||
HbA1c-21R | Native Rhesus monkey Glycated Hemoglobin A1c (HbA1c) Protein | +Inquiry |
LDL-400H | Native Human Low Density Lipoprotein, High Oxidized | +Inquiry |
Vtn-694M | Native Mouse Vitronectin | +Inquiry |
TF-48P | Native Pig Transferrin (TRF) Protein | +Inquiry |
Lectin-8983P | Active Native Phaseolus vulgaris (red kidney bean) Lectin | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRIM3-785HCL | Recombinant Human TRIM3 293 Cell Lysate | +Inquiry |
C2CD2L-1791HCL | Recombinant Human C2CD2L cell lysate | +Inquiry |
ACOT12-9090HCL | Recombinant Human ACOT12 293 Cell Lysate | +Inquiry |
IKZF5-5250HCL | Recombinant Human IKZF5 293 Cell Lysate | +Inquiry |
MYO6-4006HCL | Recombinant Human MYO6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket