Recombinant Full Length Escherichia Coli O6:K15:H31 Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL22459EF |
Product Overview : | Recombinant Full Length Escherichia coli O6:K15:H31 Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q0TJD9) (1-582aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-582) |
Form : | Lyophilized powder |
AA Sequence : | MHNDKDLSTWQTFRRLWPTIAPFKAGLIVAGVALILNAASDTFMLSLLKPLLDDGFGKTD RSVLMWMPLVVIGLMILRGITSYISSYCISWVSGKVVMTMRRRLFGHMMGMPVSFFDKQS TGTLLSRITYDSEQVASSSSGALITVVREGASIIGLFIMMFYYSWQLSIILIVLAPIVSI AIRVVSKRFRNISKNMQNTMGQVTTSAEQMLKGHKEVLIFGGQEVETKRFDKVSNRMRLQ GMKMVSASSISDPIIQLIASLALAFVLYAASFPSVMDSLTAGTITVVFSSMIALMRPLKS LTNVNAQFQRGMAACQTLFTILDSEQEKDEGKRVIERATGDVEFRNVTFTYPGRDVPALR NINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGEILMDGHDLREYTLASLRNQVA LVSQNVHLFNDTVANNIAYARTEQYSREQIEEAARMAYAMDFINKMDNGLDTVIGENGVL LSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLS TIEKADEIVVVEDGVIVERGTHNDLLEHRGVYAQLHKMQFGQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; ECP_0925; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q0TJD9 |
◆ Recombinant Proteins | ||
GMPPB-6086H | Recombinant Human GMPPB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
REPA-0107S | Recombinant Staphylococcus aureus (strain: TY825) REPA protein, His-tagged | +Inquiry |
ATG4C-2548H | Recombinant Human ATG4C Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MMP1A-9914M | Recombinant Mouse MMP1A Protein | +Inquiry |
APOC4-636M | Recombinant Mouse APOC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Thyroid-018H | Human Thyroid Lysate, Total Protein | +Inquiry |
HP-146R | Native Rabbit Hemoglobin | +Inquiry |
COL5-136H | Native Human Collagen Type IV | +Inquiry |
LDH5-24H | Active Native Human Lactate Dehydrogenase 5 | +Inquiry |
GGT1-5353H | Native Human Gamma-Glutamyltransferase 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM151B-6422HCL | Recombinant Human FAM151B 293 Cell Lysate | +Inquiry |
CELA2A-7594HCL | Recombinant Human CELA2A 293 Cell Lysate | +Inquiry |
Uterus-548R | Rhesus monkey Uterus Lysate | +Inquiry |
FAM164A-6414HCL | Recombinant Human FAM164A 293 Cell Lysate | +Inquiry |
KCNK5-5033HCL | Recombinant Human KCNK5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket