Recombinant Full Length Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL26997EF |
Product Overview : | Recombinant Full Length Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (P60753) (1-582aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-582) |
Form : | Lyophilized powder |
AA Sequence : | MHNDKDLSTWQTFRRLWPTIAPFKAGLIVAGVALILNAASDTFMLSLLKPLLDDGFGKTD RSVLVWMPLVVIGLMILRGITSYVSSYCISWVSGKVVMTMRRRLFGHMMGMPVSFFDKQS TGTLLSRITYDSEQVASSSSGALITVVREGASIIGLFIMMFYYSWQLSIILIVLAPIVSI AIRVVSKRFRNISKNMQNTMGQVTTSAEQMLKGHKEVLIFGGQEVETKRFDKVSNRMRLQ GMKMVSASSISDPIIQLIASLALAFVLYAASFPSVMDSLTAGTITVVFSSMIALMRPLKS LTNVNAQFQRGMAACQTLFTILDSEQEKDEGKRVIERATGDVEFRNVTFTYPGRDVPALR NINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGEILMDGHDLREYTLASLRNQVA LVSQNVHLFNDTVANNIAYARTEQYSREQIEEAARMAYAMDFINKMDNGLDTVIGENGVL LSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLS TIEKADEIVVVEDGVIVERGTHNDLLEHRGVYAQLHKMQFGQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; Z1260; ECs0997; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | P60753 |
◆ Recombinant Proteins | ||
SLC50A1-8392M | Recombinant Mouse SLC50A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CEACAM6-221H | Recombinant Human CEACAM6, C13&N15-labeled | +Inquiry |
MBOAT2-3606R | Recombinant Rat MBOAT2 Protein | +Inquiry |
NR2E3-6739HF | Recombinant Full Length Human NR2E3 Protein, GST-tagged | +Inquiry |
GNRHR-2270R | Recombinant Rat GNRHR Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
IGHA2 -19H | Native Human IgA2 | +Inquiry |
KLK4-239R | Native Rat Kallikrein | +Inquiry |
Cry1Ab-523 | Native Bacillus thuringiensis Cry1Ab Protein | +Inquiry |
Collagen Type I-03R | Native Rat Collagen Type I (Atelocollagen) Protein | +Inquiry |
TG-393H | Native Human Thyroglobulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
XYLB-1941HCL | Recombinant Human XYLB cell lysate | +Inquiry |
PLCXD1-3125HCL | Recombinant Human PLCXD1 293 Cell Lysate | +Inquiry |
IGFBP6-1902HCL | Recombinant Human IGFBP6 cell lysate | +Inquiry |
B4GALT7-8536HCL | Recombinant Human B4GALT7 293 Cell Lysate | +Inquiry |
C6orf162-7991HCL | Recombinant Human C6orf162 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket