Recombinant Full Length Yersinia Pestis Bv. Antiqua Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL34597YF |
Product Overview : | Recombinant Full Length Yersinia pestis bv. Antiqua Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q1CA68) (1-582aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Yersinia pestis bv. Antiqua |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-582) |
Form : | Lyophilized powder |
AA Sequence : | MMNDKDLSTWQTFRRLWPTISPYKAGLIVAAIALILNAASDTFMLSLLKPLLDDGFGNSN SSILKWMPLAVIGLMVVRGVTGFVSSYCISWVSGKVVMHIRRRLFSHMMGMPVSFFDQQS TGTLLSRITYDSEQVAASSSSALVTVVREGASIIGLFIMMFYYSWQLSLILIVIAPIVSI SIRLVSKRFRNISKNMQNTMGEVTTSAEQMLKGHKEVLIFGGQKVETERFDAVSNRMRQQ GMKLVSASSISDPIIQLIASFALALVLYAASFPSVMETLTAGTITVVFSAMIALMRPLKS LTNVNTQFQRGMAACQTLFSILDMEQEKDEGKLEVERAKGDIEFRHVTFYYPGKDTPALN DINIHLEAGKTVALVGRSGSGKSTIANLLTRFYDVSEGSILLDGHDLRDYRLGALRNQVA LVSQNVHLFNDTVANNIAYARNEQYSRAEIEEAARMAYAMDFINKMEHGLDTVIGENGIM LSGGQRQRIAIARALLRNCPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLS TIEKADEIVVIEDGRIVERGVHAELLVQQGVYAQLNRMQFGQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; YPA_0686; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q1CA68 |
◆ Recombinant Proteins | ||
GDF15-101H | Recombinant Human GDF15 Protein, Ala197-Ile308, N-hFc tagged, Biotinylated | +Inquiry |
Nrp2-15R | Recombinant Rat Nrp2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SAMM50-14660M | Recombinant Mouse SAMM50 Protein | +Inquiry |
SCO0409-514S | Recombinant Streptomyces coelicolor A3(2) SCO0409 protein, His-tagged | +Inquiry |
SYCE2-8904M | Recombinant Mouse SYCE2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
KLK3-8248H | Native Human Prostate Specific Antigen | +Inquiry |
IgA2-211H | Native Human Immunoglobulin A2 (IgA2) | +Inquiry |
PMPCB-284H | Native Human PMPCB, DDK-tagged | +Inquiry |
S100A14-394H | Native Human S100A14 protein(Gly2-His104), His-tagged | +Inquiry |
CTSS-27405TH | Native Human CTSS | +Inquiry |
◆ Cell & Tissue Lysates | ||
RSV-G-1817RCL | Recombinant RSV RSV-G cell lysate | +Inquiry |
VEPH1-414HCL | Recombinant Human VEPH1 293 Cell Lysate | +Inquiry |
OR7C1-3556HCL | Recombinant Human OR7C1 293 Cell Lysate | +Inquiry |
EXOSC10-6504HCL | Recombinant Human EXOSC10 293 Cell Lysate | +Inquiry |
MCM4-4418HCL | Recombinant Human MCM4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket