Recombinant Full Length Saccharophagus Degradans Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL29187SF |
Product Overview : | Recombinant Full Length Saccharophagus degradans Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q21NS8) (1-586aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Saccharophagus degradans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-586) |
Form : | Lyophilized powder |
AA Sequence : | MSTPAKPTSVESYKRLLSYAFKYKAYFIISFIGFGVFAAMEAQLINILEYFVDRLEGRPS APVLGLSADVTSSLWFVPISVVVLSIIRGIGAYFGNFYMSLVGLNVITNLRRQIFSQMIY LPQSFYDTKNSGELISLLVYNIEQVTGSVTNAVKTLFRDGMSVAWFLAMMLIINWKLTLA FICVAPVLGGLMYIASKYFRKVSHKIQSAVGRVSHVATESIQGIKLVKSYGGEKYELDRF NDATNQNLHYGTKFERVSAFQTPVLHIVLALALAVTFYLIMILWDSDSSKAVVYATYAAA IAKPFRQLTKINSIIQKGLAAADTIFEVLDLQAEPNSGQQKLNAPKGRVELKDVHFGYNQ DTPALNGISFAIEPGQTVALVGSSGSGKSTIVSLLLRFYDNQQGSITIDGTPIQSLELHN LREHIALVNQQTILFNDTIAANIAYGSEHIDEARIQDAAKQANAHDFIMALPNGYQTPAG EDGSRLSGGQRQRIAIARALYKNAPILILDEATSALDNESEKQIQSALDELKQGRTTLVI AHRLSTIENADTILVMDNGRIVEAGNHQTLLDRSGVYANLYHSQFS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; Sde_0387; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q21NS8 |
◆ Native Proteins | ||
KRT19-40H | Native Human KRT19 protein | +Inquiry |
IgM-210R | Native Rabbit IgM | +Inquiry |
FSH-1566P | Active Native Porcine Stimulating Hormone | +Inquiry |
IgA2-211H | Native Human Immunoglobulin A2 (IgA2) | +Inquiry |
C1S-550H | Active Native Human C1S Enzyme | +Inquiry |
◆ Cell & Tissue Lysates | ||
AKTIP-8926HCL | Recombinant Human AKTIP 293 Cell Lysate | +Inquiry |
TYW1-612HCL | Recombinant Human TYW1 293 Cell Lysate | +Inquiry |
DHFR-353HCL | Recombinant Human DHFR cell lysate | +Inquiry |
F13A1-6485HCL | Recombinant Human F13A1 293 Cell Lysate | +Inquiry |
RER1-2419HCL | Recombinant Human RER1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket