Recombinant Full Length Legionella Pneumophila Subsp. Pneumophila Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL18058LF |
Product Overview : | Recombinant Full Length Legionella pneumophila subsp. pneumophila Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q5ZUH9) (1-588aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Legionella Pneumophila |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-588) |
Form : | Lyophilized powder |
AA Sequence : | MKNNLPIKSRLLYKRLLSYVKPFWPVLLLGVLANILYSGIDAGFTYMTKLFLDKSFITID LNFVKQIPLIVLIGITLRGLVSSLGSYCMTWVARSVVKVLRQTVFSHIIHLPADYYDEAT SGQLLSKILYDVEQVAQVSADALTDFIQNICLVIGLLTVMMVICWQLSLMFLLTIPFVGI IVNYTNKRVRRISHKVQKTMGEVTEIASEAIEGYRVVRIFGGERYEITKFNKATEYSRKN DMKVAISKAINVSGVQLVIAIGIATIIMAAIHLSTVITISAGSFLAIIAAMLQLIKPMKT LTTLNATIQRGLAGAESVFNLLDLPLERNNGLILKEKIRGEIEFKHVYHAYRQGQNILHD VNFVIEAGTSVALVGHSGSGKTTIASLLPRFYELSQGMITLDGMPIQQLSLESLRKQMSL VSQNVTLFNDTLANNIAYGRFDASREQIITAAKLAYADEFIKQLPDGYDTRVGENGVLLS GGQRQRIAIARAILKDAPILILDEATSALDSESEHYIQAALEQVMKGRTTLIIAHRLSTI KHAHKIIVLQHGRIVEQGSHQELLDMDGHYAQLYKVQQFGRINEEVVA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; lpg1819; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q5ZUH9 |
◆ Recombinant Proteins | ||
CD3E&CD3D-3522H | Recombinant Human CD3E&CD3D protein, hFc-tagged | +Inquiry |
CYP2E1-0006H | Recombinant Human CYP2E1 Protein (L32-S493), His tagged | +Inquiry |
ORF8-529V | Recombinant SARS-CoV-2 ORF8 protein, His-tagged | +Inquiry |
CCNB1-0650H | Recombinant Human CCNB1 Protein, GST-Tagged | +Inquiry |
ECH1-4161HF | Recombinant Full Length Human ECH1 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Fgg-5421R | Native Rat Fibrinogen Gamma Chain | +Inquiry |
Spinalcord-C57M | Native Mouse C57 Spinal cord protein | +Inquiry |
C1S-550H | Active Native Human C1S Enzyme | +Inquiry |
VCL-899T | Native Turkey VCL Protein | +Inquiry |
Y. enterocolitica-29 | Native Yersinia enterocolitica O:3 Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM222B-8233HCL | Recombinant Human C17orf63 293 Cell Lysate | +Inquiry |
CXorf40B-210HCL | Recombinant Human CXorf40B lysate | +Inquiry |
ULK3-1883HCL | Recombinant Human ULK3 cell lysate | +Inquiry |
TCP1-1169HCL | Recombinant Human TCP1 293 Cell Lysate | +Inquiry |
CYP3A4-436HCL | Recombinant Human CYP3A4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket