Recombinant Full Length Chromohalobacter Salexigens Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL12970CF |
Product Overview : | Recombinant Full Length Chromohalobacter salexigens Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q1QX69) (1-579aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chromohalobacter salexigens |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-579) |
Form : | Lyophilized powder |
AA Sequence : | MRNATSWSLYRRLLSYVRPYWKAFLAAVVGYAIYAASSTALAEMMKRLIDGIQNPDAAFR LMLPLFVIGMFAARGVGTFLGTYYMSDVARNVVHALRCEVFNHMLRLPGRFFDMHSSGHL LSRVTYHVEQVTGAATNAITIILREGLFVIGLVSYLLWTNWMLTLIFMAVTPLIGLVVNY TSKRFRRLSRRIQNSMGDVTHVASEALSGYRVVRTHGAEAYEKARFAEASDYNREQSMKV ALTKAVSTPVIQLLVALSLAGLVWLAMSPALMASMTPGEFVAFITAASLMAKPVRQLTEV NSTIQKGLSASQELFGLLEQPPEVDEGSYVPARIDGRVRFEGVRFRYGEDQAEVLKGIDL DVPQGEMIAIVGRSGSGKSTLVSLMPRFYRPTEGRVLLDDVDIQEYALSPLRQRIALVSQ QVTLFNTTIAANIAYGHPDADREAVESAARSAYAHEFIERLPNGYDTVVGDNGVMLSGGQ RQRLAIARAIFKDAPLLVLDEATSALDTESERYIQQALERVCRGRTTFVIAHRLSTIERA DRILVMEQGEIIESGTHGELLAQDGAYAALHQLQFQEAE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; Csal_1586; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q1QX69 |
◆ Recombinant Proteins | ||
F7-2880H | Recombinant Human F7 protein, His-SUMO-tagged | +Inquiry |
JAGN1-2146R | Recombinant Rhesus Macaque JAGN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cmklr1-1039M | Recombinant Mouse Cmklr1 Full Length Transmembrane protein, His-tagged | +Inquiry |
RFL32391AF | Recombinant Full Length Cytochrome B(Cob) Protein, His-Tagged | +Inquiry |
PAN2-2165C | Recombinant Chicken PAN2 | +Inquiry |
◆ Native Proteins | ||
VTN-2H | Native Human monomeric vitronectin, Biotin labeled | +Inquiry |
LDL-407H | Native Human Low Density Lipoprotein, Acetylated, DiI labeled | +Inquiry |
TNNI3-221H | Native Human TNNI3 | +Inquiry |
CHOD-22 | Active Native Cholesterol esterase | +Inquiry |
Lectin-1842S | Active Native Solanum Tuberosum Lectin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZMAT2-1984HCL | Recombinant Human ZMAT2 cell lysate | +Inquiry |
ZNF615-37HCL | Recombinant Human ZNF615 293 Cell Lysate | +Inquiry |
CAV3-7819HCL | Recombinant Human CAV3 293 Cell Lysate | +Inquiry |
GSG1L-5724HCL | Recombinant Human GSG1L 293 Cell Lysate | +Inquiry |
ARPC1B-8686HCL | Recombinant Human ARPC1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket