Recombinant Full Length Ajellomyces Dermatitidis Formation Of Crista Junctions Protein 1(Fcj1) Protein, His-Tagged
Cat.No. : | RFL6585AF |
Product Overview : | Recombinant Full Length Ajellomyces dermatitidis Formation of crista junctions protein 1(FCJ1) Protein (C5GFG7) (20-653aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ajellomyces dermatitidis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (20-653) |
Form : | Lyophilized powder |
AA Sequence : | SSTPNAAATPELSQKATNSTSTKPPGPNDPDVRSPASPSTGSTLHPETVSKPPQSPAVQG QTSPGSSVQPPEHEPSPPPPRPPPAPKTGLLRKLLYLFLTTGLAYAGGVWYSLRSDNFYD FFTEYIPYGEEAVLYLEERDFRSRFPSIARQINRRVSAPRDEGAQVMIPGRSGLSWKVAE EQQEASDVTKQGQHISATDANELTEETKVAEKAKEDVKSKPVAKKAEAAEPKSSPKVVEP HPAKAEENTSLEAPRQPVVPAAAAIEHLGLDNEDEPVVQDLVKVFNDIITVISADESASK FSVPIAKAKEELEKIGDRIVALKNDAQESAKEEIRNAQAALDKSAAELVRHINEVRAQDA AEFREEFESEREKISKSYQEKVTTELQRAHEVAEQRLRNELVEQAIELNRKFLADVKTLV ENEREGRLSKLAELTANVAELERLTAGWSDVIDINLRTQQLQVAVDSVRTTLENSEVPRP FIRELAAVKELASNDEVVAAAIASISPTAYQRGIPSPAQLVDRFRRVASEVRKASLLPEN AGITSHAASLVLSKVMLKKQGTPVGNDVESILTRTENLLEEGNFDEAAREMNSLQGWAKL LSKDWLADVRRVLEVKQALEVIETEARLRCLQVE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MIC60 |
Synonyms | MIC60; BDCG_03160; MICOS complex subunit MIC60; Mitofilin |
UniProt ID | C5GFG7 |
◆ Recombinant Proteins | ||
MPP1-5652M | Recombinant Mouse MPP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Hes6-3387M | Recombinant Mouse Hes6 Protein, Myc/DDK-tagged | +Inquiry |
RFL18420PF | Recombinant Full Length Pinus Koraiensis Atp Synthase Subunit A, Chloroplastic(Atpi) Protein, His-Tagged | +Inquiry |
ATP2A2-2565H | Recombinant Human ATP2A2 protein, His-tagged | +Inquiry |
SMAD7-561H | Recombinant Human SMAD7 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Hp-25 | Native Helicobacter pylori Antigen | +Inquiry |
Fibrinogen-01S | Native Atlantic salmon Fibrinogen | +Inquiry |
Actin-21R | Native Rabbit Actin Protein | +Inquiry |
Neuraminidase-011C | Active Native Clostridium perfringens Choloylglycine Hydrolase | +Inquiry |
Lectin-1722C | Native Canavalia ensiformis Lectin, Biotin conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
SARS2-2060HCL | Recombinant Human SARS2 293 Cell Lysate | +Inquiry |
XCL1-466HCL | Recombinant Human XCL1 cell lysate | +Inquiry |
CEBPB-7598HCL | Recombinant Human CEBPB 293 Cell Lysate | +Inquiry |
ASB8-8659HCL | Recombinant Human ASB8 293 Cell Lysate | +Inquiry |
C12orf45-77HCL | Recombinant Human C12orf45 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MIC60 Products
Required fields are marked with *
My Review for All MIC60 Products
Required fields are marked with *
0
Inquiry Basket