Recombinant Full Length Ajellomyces Capsulata Formation Of Crista Junctions Protein 1(Fcj1) Protein, His-Tagged
Cat.No. : | RFL10095AF |
Product Overview : | Recombinant Full Length Ajellomyces capsulata Formation of crista junctions protein 1(FCJ1) Protein (C0NUJ9) (43-685aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ajellomyces capsulatus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (43-685) |
Form : | Lyophilized powder |
AA Sequence : | ALARKSNAGRRCSLTPNTATTSQFFQKAASSTSTKPPGPSDADVRSPASPSSRSSLRPES IPKPPQSPPVQGQTSPGSEVLPPDHESSTPPPPPGPKSSRLRKLLYLFLTAGLAYAGGVW YSLRSDNFYDFFTEYIPYGEEAVLYLEERDFRNRFPHVTKQINRRVTVPKDEGAQVTIPS GSGLSWKVAEEQQEATDMTKKGRRMGTAHANEPTKDIKVAEKAKEEVKSKSAAKKEDVAA NIPIQEALEPQPAKTEEKNLEAPRQPAVPAVTAIERLVQDKADEPVVQDLVKVFNDVISV ISADESASKFAGPIAKAKEELQRIGDRIVALKKDAQESAQEEIRNAHAAFDKSAAELIRR IDEVRTQDAAEFREEFESEREKIARSYQEKVNTELQRAHEVAEQRLRNELVEQAIELNRK FLSDVKTLVENEREGRLSKLAELSANVAELERLTAGWSDVVDINLKTQQLQVAVDAVRTT LENSDVPRPFVRELAAVKELASNDEVVAAAIASISPAAYQRGIPSAAQLVDRFRRVASEV RKARLLPENAGITSHAASLVLSKVMLKKQGLPTSDDVESILTRTENFLEEGNFDEAAREM NSLQGWAKLLSKDWLADVRRVLEVKQALEIIETEARLRCLQVE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MIC60 |
Synonyms | MIC60; HCBG_07030; MICOS complex subunit MIC60; Mitofilin |
UniProt ID | C0NUJ9 |
◆ Recombinant Proteins | ||
TFF1-674H | Recombinant Human TFF1 protein, hFc-tagged | +Inquiry |
XKR8-10227M | Recombinant Mouse XKR8 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL36384HF | Recombinant Full Length Human Olfactory Receptor 51F1(Or51F1) Protein, His-Tagged | +Inquiry |
clpB-1414E | Recombinant Escherichia coli O6:H1 clpB Protein (M1-Q857), His-tagged | +Inquiry |
PRKAR2B-398H | Recombinant Human PRKAR2B Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
SNCA-27339TH | Native Human SNCA | +Inquiry |
Collagen Type I-524B | Native Bovine Collagen Type I Protein, FITC-conjugated | +Inquiry |
Alb-7992M | Native Mouse Serum Albumin | +Inquiry |
PTGS2-57S | Native Sheep PTGS2 Protein | +Inquiry |
Hemoglobin Glutamer-01B | Native Bovine Hemoglobin Glutamer | +Inquiry |
◆ Cell & Tissue Lysates | ||
TBCCD1-1217HCL | Recombinant Human TBCCD1 293 Cell Lysate | +Inquiry |
IGHD-840HCL | Recombinant Human IGHD cell lysate | +Inquiry |
Diaphragm-512D | Dog Diaphragm Lysate, Total Protein | +Inquiry |
SCRN1-2021HCL | Recombinant Human SCRN1 293 Cell Lysate | +Inquiry |
ZNF490-64HCL | Recombinant Human ZNF490 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All MIC60 Products
Required fields are marked with *
My Review for All MIC60 Products
Required fields are marked with *
0
Inquiry Basket