Recombinant Full Length Human PNPLA3 Protein, C-Flag-tagged

• Cat.No.: PNPLA3-26HFL
• Product Overview: Recombinant Full Length Human PNPLA3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Description: The protein encoded by this gene is a triacylglycerol lipase that mediates triacylglycerol hydrolysis in adipocytes. The encoded protein, which appears to be membrane bound, may be involved in the balance of energy usage/storage in adipocytes.
• Source: Mammalian cells
• Species: Human
• Tag: Flag
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 52.7 kDa
• AA Sequence: MYDAERGWSLSFAGCGFLGFYHVGATRCLSEHAPHLLRDARMLFGASAGALHCVGVLSGIPLEQTLQVLS DLVRKARSRNIGIFHPSFNLSKFLRQGLGKCLPANVHQLISGKIGISLTRVSDGENVLVSDFRSKDEVVD ALVCSCFMPFYSGLIPPSFRGVRYVDGGVSDNVPFIDAKTTITVSPFYGEYDICPKVKSTNFLHVDITKL SLRLCTGNLYLLSRAFVPPDLKVLGEICLRGYLDAFRFLEEKGICNRPQPGLKSSSEGMDPEVAMPSWAN MSLDSSPESAALAVRLEGDELLDHLRLSILPWDESILDTLSPRLATALSEEMKDKGGYMSKICNLLPIRI MSYVMLPCTLPVESAIAIVQRLVTWLPDMPDDVLWLQWVTSQVFTRVLMCLLPASRSQMPVSSQQASPCT
  PEQDWPCWTPCSPEGCPAETKAEATPRSILRSSLNFFLGNKVPAGAEGLSTFPSFSLEKSLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Pathways: Glycerolipid metabolism, Glycerophospholipid metabolism, Limonene and pinene degradation, Metabolic pathways, Phenylalanine metabolism, Tyrosine metabolism
• Full Length: Full L.

Gene Information

• Gene Name: PNPLA3 patatin like phospholipase domain containing 3 [ Homo sapiens (human) ]
• Official Symbol: PNPLA3
• Synonyms: ADPN; C22orf20; iPLA(2)epsilon
• Gene ID: 80339
• mRNA Refseq: NM_025225.3
• Protein Refseq: NP_079501.2
• MIM: 609567
• UniProt ID: Q9NST1