Recombinant Full Length Human PNPLA3 Protein, C-Flag-tagged
Cat.No. : | PNPLA3-26HFL |
Product Overview : | Recombinant Full Length Human PNPLA3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a triacylglycerol lipase that mediates triacylglycerol hydrolysis in adipocytes. The encoded protein, which appears to be membrane bound, may be involved in the balance of energy usage/storage in adipocytes. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 52.7 kDa |
AA Sequence : | MYDAERGWSLSFAGCGFLGFYHVGATRCLSEHAPHLLRDARMLFGASAGALHCVGVLSGIPLEQTLQVLS DLVRKARSRNIGIFHPSFNLSKFLRQGLGKCLPANVHQLISGKIGISLTRVSDGENVLVSDFRSKDEVVD ALVCSCFMPFYSGLIPPSFRGVRYVDGGVSDNVPFIDAKTTITVSPFYGEYDICPKVKSTNFLHVDITKL SLRLCTGNLYLLSRAFVPPDLKVLGEICLRGYLDAFRFLEEKGICNRPQPGLKSSSEGMDPEVAMPSWAN MSLDSSPESAALAVRLEGDELLDHLRLSILPWDESILDTLSPRLATALSEEMKDKGGYMSKICNLLPIRI MSYVMLPCTLPVESAIAIVQRLVTWLPDMPDDVLWLQWVTSQVFTRVLMCLLPASRSQMPVSSQQASPCT PEQDWPCWTPCSPEGCPAETKAEATPRSILRSSLNFFLGNKVPAGAEGLSTFPSFSLEKSLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Glycerolipid metabolism, Glycerophospholipid metabolism, Limonene and pinene degradation, Metabolic pathways, Phenylalanine metabolism, Tyrosine metabolism |
Full Length : | Full L. |
Gene Name | PNPLA3 patatin like phospholipase domain containing 3 [ Homo sapiens (human) ] |
Official Symbol | PNPLA3 |
Synonyms | ADPN; C22orf20; iPLA(2)epsilon |
Gene ID | 80339 |
mRNA Refseq | NM_025225.3 |
Protein Refseq | NP_079501.2 |
MIM | 609567 |
UniProt ID | Q9NST1 |
◆ Recombinant Proteins | ||
PNPLA3-922HF | Recombinant Full Length Human PNPLA3 Protein, GST-tagged | +Inquiry |
PNPLA3-1819H | Recombinant Human PNPLA3 protein, GST-tagged | +Inquiry |
PNPLA3-367H | Recombinant Human PNPLA3 protein, MYC/DDK-tagged | +Inquiry |
PNPLA3-321H | Recombinant Human PNPLA3, His-tagged | +Inquiry |
Pnpla3-588M | Recombinant Mouse Pnpla3 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PNPLA3-3068HCL | Recombinant Human PNPLA3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PNPLA3 Products
Required fields are marked with *
My Review for All PNPLA3 Products
Required fields are marked with *
0
Inquiry Basket