Recombinant Human PNPLA3 protein, His-tagged

• Cat.No.: PNPLA3-1820H
• Product Overview: Recombinant Human PNPLA3(229-339aa) protein was fused to His-tag and expressed in E.coli.

Specification

• Description: The protein encoded by this gene is a triacylglycerol lipase that mediates triacylglycerol hydrolysis in adipocytes. The encoded protein, which appears to be membrane bound, may be involved in the balance of energy usage/storage in adipocytes.
• Source: E.coli
• Species: Human
• Tag: His
• Form: Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5% trehalose and 5% mannitol are added as protectants before lyophilization.
• Molecular Mass: 18 kDa
• Protein length: 111
• AA Sequence: PDLKVLGEICLRGYLDAFRFLEEKGICNRPQPGLKSSSEGMDPEVAMPSWANMSLDSSPESAALAVRLEGDELLDHLRLSILPWDESILDTLSPRLATALSEEMKDKGGYM
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8 centigrade for (1-2 weeks).
  Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 3 months. Avoid repeat freeze-thaw cycles.
• Reconstitution: Buffer containing 50% glycerol is recommended for reconstitution.
• Shipping: The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature.

Gene Information

• Gene Name: PNPLA3
• Official Symbol: PNPLA3
• Synonyms: ADPN; C22orf20; iPLA(2)epsilon
• Gene ID: 80339
• mRNA Refseq: NM_025225.3
• Protein Refseq: NP_079501.2
• MIM: 609567
• UniProt ID: Q9NST1