Recombinant Full Length Human PGAM1 Protein, C-Flag-tagged

• Cat.No.: PGAM1-1073HFL
• Product Overview: Recombinant Full Length Human PGAM1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Description: The protein encoded by this gene is a mutase that catalyzes the reversible reaction of 3-phosphoglycerate (3-PGA) to 2-phosphoglycerate (2-PGA) in the glycolytic pathway. Two transcript variants encoding different isoforms have been found for this gene.
• Source: Mammalian cells
• Species: Human
• Tag: Flag
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 28.6 kDa
• AA Sequence: MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTV LDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDR RYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNL
  PTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Pathways: Glycolysis / Gluconeogenesis, Metabolic pathways
• Full Length: Full L.

Gene Information

• Gene Name: PGAM1 phosphoglycerate mutase 1 [ Homo sapiens (human) ]
• Official Symbol: PGAM1
• Synonyms: PGAMA; PGAM-B; HEL-S-35
• Gene ID: 5223
• mRNA Refseq: NM_002629.4
• Protein Refseq: NP_002620.1
• MIM: 172250
• UniProt ID: P18669