Recombinant Human PGAM1 protein, GST-tagged

Source :	E. coli
Species :	Human
Tag :	GST
Form :	The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
Protein length :	1-254 aa
AA Sequence :	MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKK
Purity :	95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage :	Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution :	Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Name	PGAM1 phosphoglycerate mutase 1 (brain) [ Homo sapiens ]
Official Symbol	PGAM1
Synonyms	PGAM1; phosphoglycerate mutase 1 (brain); PGAMA; phosphoglycerate mutase 1; PGAM B; Phosphoglycerate mutase A; nonmuscle form; BPG-dependent PGAM 1; phosphoglycerate mutase isozyme B; phosphoglycerate mutase A, nonmuscle form; PGAM-B;
Gene ID	5223
mRNA Refseq	NM_002629
Protein Refseq	NP_002620
MIM	172250
UniProt ID	P18669