Recombinant Human PGAM1 protein, GST-tagged
Cat.No. : | PGAM1-1839H |
Product Overview : | Recombinant Human PGAM1 protein(1-254 aa), fused to GST tag, was expressed in E. coli. |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Source : | E. coli |
Species : | Human |
Tag : | GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
Protein length : | 1-254 aa |
AA Sequence : | MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKK |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PGAM1 phosphoglycerate mutase 1 (brain) [ Homo sapiens ] |
Official Symbol | PGAM1 |
Synonyms | PGAM1; phosphoglycerate mutase 1 (brain); PGAMA; phosphoglycerate mutase 1; PGAM B; Phosphoglycerate mutase A; nonmuscle form; BPG-dependent PGAM 1; phosphoglycerate mutase isozyme B; phosphoglycerate mutase A, nonmuscle form; PGAM-B; |
Gene ID | 5223 |
mRNA Refseq | NM_002629 |
Protein Refseq | NP_002620 |
MIM | 172250 |
UniProt ID | P18669 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All PGAM1 Products
Required fields are marked with *
My Review for All PGAM1 Products
Required fields are marked with *
0
Inquiry Basket