Recombinant Human PGAM1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PGAM1-5534H
• Product Overview: PGAM1 MS Standard C13 and N15-labeled recombinant protein (NP_002620) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: The protein encoded by this gene is a mutase that catalyzes the reversible reaction of 3-phosphoglycerate (3-PGA) to 2-phosphoglycerate (2-PGA) in the glycolytic pathway. Two transcript variants encoding different isoforms have been found for this gene.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 28.8 kDa
• AA Sequence: MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PGAM1 phosphoglycerate mutase 1 [ Homo sapiens (human) ]
• Official Symbol: PGAM1
• Synonyms: PGAM1; phosphoglycerate mutase 1 (brain); PGAMA; phosphoglycerate mutase 1; PGAM B; Phosphoglycerate mutase A; nonmuscle form; BPG-dependent PGAM 1; phosphoglycerate mutase isozyme B; phosphoglycerate mutase A, nonmuscle form; PGAM-B
• Gene ID: 5223
• mRNA Refseq: NM_002629
• Protein Refseq: NP_002620
• MIM: 172250
• UniProt ID: P18669