Recombinant Human PGAM1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PGAM1-5534H |
Product Overview : | PGAM1 MS Standard C13 and N15-labeled recombinant protein (NP_002620) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a mutase that catalyzes the reversible reaction of 3-phosphoglycerate (3-PGA) to 2-phosphoglycerate (2-PGA) in the glycolytic pathway. Two transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 28.8 kDa |
AA Sequence : | MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PGAM1 phosphoglycerate mutase 1 [ Homo sapiens (human) ] |
Official Symbol | PGAM1 |
Synonyms | PGAM1; phosphoglycerate mutase 1 (brain); PGAMA; phosphoglycerate mutase 1; PGAM B; Phosphoglycerate mutase A; nonmuscle form; BPG-dependent PGAM 1; phosphoglycerate mutase isozyme B; phosphoglycerate mutase A, nonmuscle form; PGAM-B; |
Gene ID | 5223 |
mRNA Refseq | NM_002629 |
Protein Refseq | NP_002620 |
MIM | 172250 |
UniProt ID | P18669 |
◆ Recombinant Proteins | ||
PGAM1-2486TH | Recombinant Human PGAM1, MYC/DDK-tagged | +Inquiry |
PGAM1-3386R | Recombinant Rhesus monkey PGAM1 Protein, His-tagged | +Inquiry |
PGAM1-14M | Active Recombinant Mouse Pgam1 protein, His-tagged (Bioactivity Validated) | +Inquiry |
PGAM1-1661H | Recombinant Human PGAM1 protein, His-tagged | +Inquiry |
Pgam1-1955M | Recombinant Mouse Phosphoglycerate Mutase 1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PGAM1-3264HCL | Recombinant Human PGAM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PGAM1 Products
Required fields are marked with *
My Review for All PGAM1 Products
Required fields are marked with *
0
Inquiry Basket