Recombinant Full Length Human Parainfluenza 2 Virus Hemagglutinin-Neuraminidase(Hn) Protein, His-Tagged
Cat.No. : | RFL35516HF |
Product Overview : | Recombinant Full Length Human parainfluenza 2 virus Hemagglutinin-neuraminidase(HN) Protein (P25465) (1-571aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | HPIV2 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-571) |
Form : | Lyophilized powder |
AA Sequence : | MEDYSNLSLKSIPKRTCRIIFRTATILGICTLIVLCSSILHEIIHLDVSSGLMDSDDSQQ GIIQPIIESLKSLIALANQILYNVAIIIPLKIDSIETVIYSALKDMHTGSMSNTNCTPGN LLLHDAAYINGLNKFLVLKSYNGTPKYGPLLNIPSFIPSATSPNGCTRIPSFSLIKTHWC YTHNVILGDCLDFTTSNQYLAMGIIQQSAAAFPIFRTMKTIYLSDGINRKSCSVTAIPGG CVLYCYVATRSEKEDYATTDLAELRLAFYYYNDTFIERVISLPNTTGQWATINPAVGSGI YHLGFILFPVYGGLIKGTPSYNKQSSRYFIPKHPNITCAGKSSEQAAAARSSYVIRYHSN RLLQSAVLICPLSDMHTARCNLVMFNNSQVMMGAEGRLYVIDNNLYYYQRSSSWWSASLF YRINTDFSKGIPPIIEAQWVPSYQVPRPGVMPCNATSFCPANCITGVYADVWPLNDPEPT SQNALNPNYRFAGAFLRNESNRTNPTFYTASASALLNTTGFNNTNHKAAYTSSTCFKNTG TQKIYCLIIIEMGSSLLGEFQIIPFLRELIP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HN |
Synonyms | HN; Hemagglutinin-neuraminidase |
UniProt ID | P25465 |
◆ Recombinant Proteins | ||
SLC4A5-5552R | Recombinant Rat SLC4A5 Protein | +Inquiry |
PDCL2-748H | Recombinant Human PDCL2 Protein, His-tagged | +Inquiry |
Scarb2-103M | Recombinant Mouse Scarb2 Protein, His (Fc)-Avi-tagged | +Inquiry |
TRAB-1929S | Recombinant Staphylococcus aureus (strain: PM64, other: HA-MRSA) TRAB protein, His-tagged | +Inquiry |
SDHD-4952R | Recombinant Rat SDHD Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Transglutaminase-88G | Active Native Guinea pig liver Transglutaminase | +Inquiry |
ALB-7993H | Native Human Serum Albumin(20% Solution) | +Inquiry |
CHC-001C | Native Clostridium Histolyticum Collagenase, Tag Free | +Inquiry |
ighg1-160M | Native Mouse Immunoglobulin G1 | +Inquiry |
KNG1-29338TH | Native Human KNG1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TCIRG1-1176HCL | Recombinant Human TCIRG1 293 Cell Lysate | +Inquiry |
RAB10-2632HCL | Recombinant Human RAB10 293 Cell Lysate | +Inquiry |
PPP4R4-2909HCL | Recombinant Human PPP4R4 293 Cell Lysate | +Inquiry |
TTC26-683HCL | Recombinant Human TTC26 293 Cell Lysate | +Inquiry |
Small Intestine-455R | Rat Small Intestine Membrane Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HN Products
Required fields are marked with *
My Review for All HN Products
Required fields are marked with *
0
Inquiry Basket