Recombinant Full Length Newcastle Disease Virus Hemagglutinin-Neuraminidase(Hn) Protein, His-Tagged
Cat.No. : | RFL17325NF |
Product Overview : | Recombinant Full Length Newcastle disease virus Hemagglutinin-neuraminidase(HN) Protein (P35743) (1-577aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | NDV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-577) |
Form : | Lyophilized powder |
AA Sequence : | MDRAVSQVALENDEREAKNTWRLIFRIAILFLTVVTLAISVASLLYSMGASTPSDLVGIP TRISRAEEKITSTLGSNQDVVDRIYKQVALESPLALLKTETTIMNAITSLSYQINGAANN SGWGAPIHDPDYIGGIGKELIVDDASDVTSFYPSAFQEHLNFIPAPTTGSGCTRIPSFDM SATHYCYTHNVILSGCRDHSHSYQYLALGVLRTSATGRVFFSTLRSINLDDTQNRKSCSV SATPLGCDMLCSKVTETEEEDYNSAVPTRMAHGRLGFDGQYHEKDLDVTTLFGDWVANYP GVGGGSFIDSRVWFSVYGGLKPNSPSDTVQEGKYVIYKRYNDTCPDEQDYQIRMAKSSYK PGRFGGKRIQQAILSIKVSTSLGEDPVLTVPPNTVTLMGAEGRILTVGTSHFLYQRGSSY FSPALLYPMTVSNKTATLHSPYTFNAFTRPGSIPCQASARCPNPCVTGVYTDPYPLIFYR NHTLRGVFGTMLDGVQARLNPASAVFDSTSRSRITRVSSSSTKAAYTTSTCFKVVKTNKT YCLSIAEISNTLFGEFRIVPLLVEILKDDGVREARSG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HN |
Synonyms | HN; Hemagglutinin-neuraminidase |
UniProt ID | P35743 |
◆ Recombinant Proteins | ||
Ifna5-626H | Recombinant Rat Ifna5 Protein, His-tagged | +Inquiry |
FAM190B-1595R | Recombinant Rhesus monkey FAM190B Protein, His-tagged | +Inquiry |
BRIX1-3097C | Recombinant Chicken BRIX1 | +Inquiry |
EED-4291H | Recombinant Human EED Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL25507XF | Recombinant Full Length Xenopus Tropicalis Organic Solute Transporter Subunit Alpha(Osta) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
LALBA-8173H | Native Human Lactalbumin | +Inquiry |
RBP4-247H | Native Human Retinol Binding Protein 4 | +Inquiry |
LTF-28999TH | Native Human LTF | +Inquiry |
MPO-8220H | Native Human Neutrophil Myeloperoxidase | +Inquiry |
FGB-35D | Native Canine Fibrinogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
PROCR-1174RCL | Recombinant Rat PROCR cell lysate | +Inquiry |
ZZZ3-9177HCL | Recombinant Human ZZZ3 293 Cell Lysate | +Inquiry |
CD99L2-2222MCL | Recombinant Mouse CD99L2 cell lysate | +Inquiry |
TMED6-1023HCL | Recombinant Human TMED6 293 Cell Lysate | +Inquiry |
Ureter-545C | Cynomolgus monkey Ureter Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All HN Products
Required fields are marked with *
My Review for All HN Products
Required fields are marked with *
0
Inquiry Basket