Recombinant Human parainfluenza 2 virus (strain Toshiba) HN protein, His-tagged
Cat.No. : | HN-34333H |
Product Overview : | Recombinant Human parainfluenza 2 virus (strain Toshiba) HN protein(P25466)(440-571aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human parainfluenza 2 virus (strain Toshiba) |
Source : | E.coli |
Tag : | His |
ProteinLength : | 440-571aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 20.5 kDa |
AASequence : | VPSYQVPRPGVMPCNATSFCPANCITGVYADVWPLNDPEPTSQNALNPNYRFAGAFLRNESNRTNPTFYTASASALLNTTGFNNTNHKAAYTSSTCFKNTGTQKIYCLIIIEMGSSLLGEFQIIPFLRELIP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
◆ Recombinant Proteins | ||
RFL7826AF | Recombinant Full Length Aspergillus Clavatus Nadh-Cytochrome B5 Reductase 2(Mcr1) Protein, His-Tagged | +Inquiry |
Prdm16-5100M | Recombinant Mouse Prdm16 Protein, Myc/DDK-tagged | +Inquiry |
EME2-3276H | Recombinant Human EME2 Protein, GST-tagged | +Inquiry |
UBE2G1-2444H | Recombinant Human UBE2G1 protein, His-tagged | +Inquiry |
PVR-559H | Recombinant Human PVR Protein (Trp21-Asn343), C-mFc and 6×His-tagged | +Inquiry |
◆ Native Proteins | ||
MDH-38P | Active Native Porcine Malate dehydrogenase | +Inquiry |
CP-8073H | Native Human Plasma Ceruloplasmin | +Inquiry |
AHSG-111H | Native Human Alpha 2 HS Glycoprotein | +Inquiry |
LDH2-19H | Active Native Human Lactate Dehydrogenase 2 | +Inquiry |
Flavin-containing Amine oxidase-010B | Native Bovine Flavin-containing Amine oxidase Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD4-2580MCL | Recombinant Mouse CD4 cell lysate | +Inquiry |
GPR151-740HCL | Recombinant Human GPR151 cell lysate | +Inquiry |
VRK2-381HCL | Recombinant Human VRK2 293 Cell Lysate | +Inquiry |
PHF21A-3230HCL | Recombinant Human PHF21A 293 Cell Lysate | +Inquiry |
MSTO1-1140HCL | Recombinant Human MSTO1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HN Products
Required fields are marked with *
My Review for All HN Products
Required fields are marked with *
0
Inquiry Basket