Recombinant Full Length Human Parainfluenza 3 Virus Hemagglutinin-Neuraminidase(Hn) Protein, His-Tagged
Cat.No. : | RFL22397HF |
Product Overview : | Recombinant Full Length Human parainfluenza 3 virus Hemagglutinin-neuraminidase(HN) Protein (P12561) (1-572aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | HPIV3 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-572) |
Form : | Lyophilized powder |
AA Sequence : | MEYWKHTNHGKDACNELGTSMATHGNKITNKITYILWTIILVLLSIIFIIVLINSIKSEK AHESLLQDVNNEFMEVTEKIQMASDNINDLIQSGVNTRLLTIQSHVQNYIPISLTQQMSD LRKFISEITIRNDNQEVPPQRITHDVGIKPLNPDDFWRCTSGLPSLMKTPKIRLMPGPGL LAMPTTVDGCVRTPSLVINDLIYAYTSNLITRGCQDIGKSYQVLQIGIITVNSDLVPDLN PRISHTFNINDNRKSCSLALLNTDVYQLCSTPKVDERSDYASSGIEDIVLDIVNHDGSIS TTRFKNNNISFDQPYAALYPSVGPGIYYKGKIIFLGYGGLEHPINENAICNTTGCPGKTQ RDCNQASHSPWFSDRRMVNSIIVVDKGLNSIPKLKVWTISMRQNYWGSEGRLLLLGNKIY IYTRSTSWHSKLQLGIIDITDYSDIRIKWTWHNVLSRPGNNECPWGHSCPDGCITGVYTD AYPLNPTGSIVSSVILDSQKTRVNPVITYSTATERVNELAIRNKTLSAGYTTTSCITHYN KGYCFHIVEINHKSLDTFQPMLFKTEIPKSCS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HN |
Synonyms | HN; Hemagglutinin-neuraminidase |
UniProt ID | P12561 |
◆ Recombinant Proteins | ||
RFL36721TF | Recombinant Full Length Rhomboid-Like Protease 4(Rom4) Protein, His-Tagged | +Inquiry |
C-0839H | Recombinant HBV C Protein (Met1-Val149), C-His tagged | +Inquiry |
CDKL2-144C | Recombinant Cynomolgus Monkey CDKL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
AOC2-349H | Recombinant Human AOC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PMEL-01H | Recombinant Human PMEL Protein, Tag Free | +Inquiry |
◆ Native Proteins | ||
TPSAB1-02H | Active Native Human TPSAB1 Protein | +Inquiry |
Collagen Type I & III-04B | Native Bovine Collagen Type I and III Protein | +Inquiry |
HbA0-9382H | Native Human Hemoglobin A0, Ferrous Stabilized | +Inquiry |
AGP-001B | Native Bovine AGP Protein | +Inquiry |
Sphingomyelinase-38S | Active Native Staphylococcus aureus Sphingomyelinase | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGR-6228HCL | Recombinant Human FGR 293 Cell Lysate | +Inquiry |
ACADSB-9112HCL | Recombinant Human ACADSB 293 Cell Lysate | +Inquiry |
CIRBP-7491HCL | Recombinant Human CIRBP 293 Cell Lysate | +Inquiry |
KLHL12-4913HCL | Recombinant Human KLHL12 293 Cell Lysate | +Inquiry |
LDHD-979HCL | Recombinant Human LDHD cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HN Products
Required fields are marked with *
My Review for All HN Products
Required fields are marked with *
0
Inquiry Basket