Recombinant Full Length Newcastle Disease Virus Hemagglutinin-Neuraminidase(Hn) Protein, His-Tagged
Cat.No. : | RFL17482NF |
Product Overview : | Recombinant Full Length Newcastle disease virus Hemagglutinin-neuraminidase(HN) Protein (P12559) (1-577aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | NDV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-577) |
Form : | Lyophilized powder |
AA Sequence : | MDRAVSQVALENDEREAKNTWRLIFRIAILFLTVVTLAISVASLLYSMGASTPSDLVGIP TRISRAEEKITSTLGSNQDVVDRIYKQVALESPLALLNTETTIMNAITSLSYQINGAANN SGWGAPIHDPDYIGGIGKELIVDDASDVTSFYPSAFQEHLNFIPAPTTGSGCTRIPSFDM SATHYCYTHNVILSGCRDHLHSHQYLALGVLRTSATGRVFFSTLRSINLDDTQNRKSCSV SATPLGCDMLCSKATETEEEDYNSAVPTRMVHGRLGFDGQYHEKDLDVTTLFGDWVANYP GVGGGSFIDSRVWFSVYGGLKPNTPSDTVQEGKYVIYKRYNDTCPDEQDYQIRMAKSSYK PGRFGGKRIQQAILSIKVSTSLGEDPVLTVPPNTVTLMGAEGRILTVGTSHFLYQRGSSY FSPALLYPMTVSNKTATLHSPYTFNAFTRPGSIPCQASARCPNSCVTGVYTDPYPLIFYR NHTLRGVFGTMLDGEQARLNPASAVFDSTSRSRITRVSSSSIKAAYTTSTCFKVVKTNKT YCLSIAEISNTLFGEFRIVPLLVEILKDDGVREARSG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HN |
Synonyms | HN; Hemagglutinin-neuraminidase |
UniProt ID | P12559 |
◆ Recombinant Proteins | ||
PGAM2-4400R | Recombinant Rat PGAM2 Protein | +Inquiry |
CIPC-3224H | Recombinant Human CIPC Protein, MYC/DDK-tagged | +Inquiry |
BOTF-927C | Recombinant Clostridium Botulinum BOTF Protein (1-436 aa), His-tagged | +Inquiry |
Cd200r1-125M | Recombinant Mouse Cd200r1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ANGPTL7-161H | Active Recombinant Human ANGPTL7 Protein, His-tagged, Biotinylated | +Inquiry |
◆ Native Proteins | ||
Proteasome 26S-38H | Native Human Proteasome 26S Protein, Tag Free | +Inquiry |
IgG1-228H | Native Human Immunoglobulin G1 (IgG1) | +Inquiry |
Lectin-1825P | Active Native Phaseolus Vulgaris Leucoagglutinin Protein, Fluorescein labeled | +Inquiry |
GALM-40P | Active Native Porcine Mutarotase | +Inquiry |
Neuraminidase-013C | Active Native Clostridium perfringens Neuraminidase Agarose, Type VI-A | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLMP-1439RCL | Recombinant Rat CLMP cell lysate | +Inquiry |
TNFRSF17-2489HCL | Recombinant Human TNFRSF17 cell lysate | +Inquiry |
CT45A5-7219HCL | Recombinant Human CT45A5 293 Cell Lysate | +Inquiry |
PF4V1-3282HCL | Recombinant Human PF4V1 293 Cell Lysate | +Inquiry |
SMAD3-001MCL | Recombinant Mouse SMAD3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All HN Products
Required fields are marked with *
My Review for All HN Products
Required fields are marked with *
0
Inquiry Basket