Recombinant Full Length Human Parainfluenza 1 Virus Hemagglutinin-Neuraminidase(Hn) Protein, His-Tagged
Cat.No. : | RFL26879HF |
Product Overview : | Recombinant Full Length Human parainfluenza 1 virus Hemagglutinin-neuraminidase(HN) Protein (P16071) (1-575aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | HPIV1 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-575) |
Form : | Lyophilized powder |
AA Sequence : | MAEKGKTNSSYWSTTRNDNSTVNTYIDTPAGKTHIWLLIATTMHTILSFIIMILCIDLII KQDTCMKTNIMTVSSMNESAKTIKETITELIRQEVISRTINIQSSVQSGIPILLNKQSRD LTQLIEKSCNRQELAQICENTIAIHHADGISPLDPHDFWRCPVGEPLLSNNPNISLLPGP SLLSGSTTISGCVRLPSLSIGDAIYAYSSNLITQGCADIGKSYQVLQLGYISLNSDMYPD LKPVISHTYDINDNRKSCSVIAAGTRGYQLCSLPTVNETTDYSSEGIEDLVFDILDLKGK TKSHRYKNEDITFDHPFSAMYPSVGSGIKIENTLIFLGYGGLTTPLQGDTKCVTNRCANV NQSVCNDALKITWLKKRQVVNVLIRINNYLSDRPKIVVETIPITQNYLGAEGRLLKLGKK IYIYTRSSGWHSHLQIGSLDINNPMTIKWAPHEVLSRPGNQDCNWYNRCPRECISGVYTD AYPLSPDAVNVATTTLYANTSRVNPTIMYSNTSEIINMLRLKNVQLEAAYTTTSCITHFG KGYCFHIVEINQTSLNTLQPMLFKTSIPKICKITS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HN |
Synonyms | HN; Hemagglutinin-neuraminidase |
UniProt ID | P16071 |
◆ Recombinant Proteins | ||
NKX2-3-6678HF | Recombinant Full Length Human NKX2-3 Protein, GST-tagged | +Inquiry |
DUSP11-12204H | Recombinant Human DUSP11, GST-tagged | +Inquiry |
RFL4403SF | Recombinant Full Length Salmonella Dublin Upf0283 Membrane Protein Ycjf(Ycjf) Protein, His-Tagged | +Inquiry |
EIF6-2544C | Recombinant Chicken EIF6 | +Inquiry |
KRT1-3144H | Recombinant Human KRT1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
HPX-29307TH | Native Human HPX | +Inquiry |
CA-242-380H | Active Native Human Cancer Antigen 242 | +Inquiry |
SAP-96H | Native Human Serum amyloid P | +Inquiry |
ALB-311H | Native Human Albumin, Texas Red Label | +Inquiry |
Lectin-1818P | Active Native Peanut Lectin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IgG-001HCL | Recombinant Human IgG cell lysate | +Inquiry |
TTC17-1853HCL | Recombinant Human TTC17 cell lysate | +Inquiry |
KCNIP4-5050HCL | Recombinant Human KCNIP4 293 Cell Lysate | +Inquiry |
WNT8B-286HCL | Recombinant Human WNT8B 293 Cell Lysate | +Inquiry |
UTP6-445HCL | Recombinant Human UTP6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HN Products
Required fields are marked with *
My Review for All HN Products
Required fields are marked with *
0
Inquiry Basket