Recombinant Full Length Ralstonia Metallidurans Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL18122CF |
Product Overview : | Recombinant Full Length Ralstonia metallidurans Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q1LQD3) (1-594aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cupriavidus metallidurans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-594) |
Form : | Lyophilized powder |
AA Sequence : | MASGANVTDNKQQTPQESDTLKRVWAYLKPEKRNFVLAIIAMGLVAASEGIIPKVVNDLL DKGFGGSYAGKLWHVPALLVGVALVRGLAQFASGYLLSQISNGVLLKMRMQMFDRMLHAP ALFFHRNTAASLINAVIFEVNQVMQILTGVLITLVRDSLTVVALLIYLFYTNWKLTLVVA VLLPAIGFVMSKVNRRLRRLNREHQALTNTAAYVVEESVGGFKVVKLHGGEAYEMSRFEA MAERLRGYSMRMAVAGGLNQPVTAFLASLALSVILTIAMIQAQGNQTTIGGFTGFVMAML LLISPLKHLADLNQPLQRGLTAAEMIFGLIDEPIEPQNGGLPLERARGDLVFDNVGFRYG DAARAALNHVSLRAAPGEVVALVGPSGSGKTTLVNLVPRFFDPTEGHILLDGQPIDRFAL ADLRRQIAFVSQDVVLFNDTVAANVAYGVHPREKIDMARVERALAAAYLTDVVKGLPEGL ETNIGDNGMKLSGGQRQRLAIARAIYKDAPILILDEATSALDSESERQVQAALESLMVGR TTLVIAHRLSTIENADRIVVLEQGRVAEQGSHAELIGKNGLYAGLHRIQFASQA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; Rmet_0757; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q1LQD3 |
◆ Native Proteins | ||
Troponin I-11H | Native Human Troponin I protein | +Inquiry |
LDH-17H | Active Native Human Lactate Dehydrogenase | +Inquiry |
IgG-7437M | Native Mouse IgG Protein | +Inquiry |
YIgG-138C | Native Chicken Yolk Immunoglobulin | +Inquiry |
DI-24 | Active Native Diaphorase (NADH) | +Inquiry |
◆ Cell & Tissue Lysates | ||
DAOA-7079HCL | Recombinant Human DAOA 293 Cell Lysate | +Inquiry |
PDE7B-3340HCL | Recombinant Human PDE7B 293 Cell Lysate | +Inquiry |
Colon-16H | Human Colon Tissue Lysate | +Inquiry |
C11orf42-75HCL | Recombinant Human C11orf42 lysate | +Inquiry |
RAD51B-2554HCL | Recombinant Human RAD51L1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket